KEGG   Ostreococcus tauri: Ot06g01850Help
Entry
Ot06g01850        CDS       T01358                                 

Definition
protein disulfide isomerase, putative (ISS)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ota  Ostreococcus tauri
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ota00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Ot06g01850
Enzymes [BR:ota01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ot06g01850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
6
AA seq 183 aa AA seqDB search
MSAGSNARARTESVLELTPENFEREVTNSTRPVFIEFYAPWCPYCKRLEPIWEELPSKLE
QAGSKTRVARMNVDTYTDYASAYAITGFPTLMLFENGRPVGAKQGLVDMTTAMKYAGVRD
EGVLAQFVPEKKLDKILSGAQVEYVQGELGEIRKELGGLDSDSRARALAALQQVESIIGV
RSL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgggatcgaacgctcgcgcgcgaacggaaagcgtgttggagctcacgcccgag
aactttgagcgcgaggtgacgaactcgactagaccggtcttcatcgagttctacgcgccg
tggtgcccgtactgcaagcggttggaaccaatatgggaggagttgccgagtaaactcgag
caggcgggatccaagacgcgcgtggcgaggatgaacgtggacacgtacacggattacgcg
agcgcgtacgccatcacgggctttccgacgttgatgttgttcgagaatggcaggccggtg
ggggcgaaacaggggttggtggacatgacgacggcgatgaagtatgcgggcgtgcgtgat
gagggcgtattggcgcagttcgtgccggagaagaagctcgataaaatattatctggggcg
caggtagagtatgtgcaaggagaactcggcgagattcgcaaggagttaggaggtctcgat
tcagactcgcgcgctcgagctctcgcggcgcttcaacaggtcgaatcaattattggcgtg
cgctcgctctga

DBGET integrated database retrieval system