KEGG   Ostreococcus tauri: Ot06g01880Help
Entry
Ot06g01880        CDS       T01358                                 

Definition
transducin family protein / WD-40 repeat family protein (ISS)
Orthology
K14298  
mRNA export factor
Organism
ota  Ostreococcus tauri
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ota00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Ot06g01880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
6
AA seq 345 aa AA seqDB search
MSWGAPTAPANPNGDFTVANPPSDGISSLEWSPVGNFLVATAWDGDVRVYCYEVAQNGQA
MPKASTKHEAPVLCSAWSADGASVFAGGCDNIAKKWDLATQQSTQVAAHDSAIRHMAWIQ
EVNLLVTGSWDRTLRYWDTRQQNPALKVQLPERCYALDVKHPLLVVGCAERQIQIFDLNR
PDVAYKNVMSPLKYQTRCVATFPDRSGYLVGSIEGRVAVQHVEDNLQSKNFTFKCHREGT
QDIYSVNSISFHPTFGTFVTAGADGNYNFWDKDSKQRLKNMNKCPAPISCGNFNRDGTIY
AYAVSYDWSKGGDNPLSNTPNNIYLHAVQETEVKPRGARTGIGRR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggggcgcgccgacggcgccggcgaacccgaacggagactttacggttgcgaac
ccgccgagcgatgggatctcctcgctcgagtggtcgccggtggggaactttttagtggcc
acggcgtgggacggcgacgtacgtgtgtactgctatgaggtggcgcaaaatggccaggcg
atgccaaaggcgtcgacgaaacacgaggcgccggtgttgtgcagcgcgtggtcagcggac
ggcgcgagcgtgttcgccgggggctgtgataacatcgccaagaagtgggatttagcgacg
cagcaatcgacgcaagtggcggcgcacgacagcgcgatcagacacatggcttggattcag
gaggttaatctcctggtcaccggttcgtgggatcgcacgctgaggtattgggacacgcga
caacaaaatcccgcgctcaaggtgcagcttccggagcgatgctacgcgctcgacgtcaag
catccgctccttgtggttggatgcgccgaaaggcagattcaaatcttcgatctgaataga
ccggatgtggcgtacaagaacgtcatgtcaccacttaaataccagactcggtgcgtggca
acgttcccagatcgctcgggctacctcgtcgggtccatcgagggacgcgtcgcggtgcaa
cacgtcgaggacaacctgcaaagtaagaactttacgttcaagtgccacagagaaggcacg
caggatatctactcggtgaactccatatctttccacccgacatttggaaccttcgttacc
gctggcgcagacggaaattataacttctgggacaaggatagcaagcagcgcctgaagaac
atgaacaagtgccctgcgccgatttcgtgcggcaactttaaccgtgacgggacgatctac
gcctacgccgtgtcgtacgattggagcaagggcggcgataacccactctctaacacgccg
aacaatatttacttgcacgctgtgcaagaaactgaggtcaaaccgcgcggagcgaggacc
ggtattgggcgtcgttga

DBGET integrated database retrieval system