KEGG   Ostreococcus tauri: Ot06g03160Help
Entry
Ot06g03160        CDS       T01358                                 

Definition
dihydropteroate synthase-like protein (ISS)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ota  Ostreococcus tauri
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ot06g03160
Enzymes [BR:ota01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Ot06g03160
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Ot06g03160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
6
AA seq 490 aa AA seqDB search
MSVLVRRASHFTASARGDRTRVVIALGSNEGDRVALFRDALRRLRSDLDFTLEAHSSLYE
TAPAYVEDQGRFLNAACVGTFPDSTSRDPLKLLDGLKSIEAALGRDFGGRRYGPRSMDLD
VIFHGEGVHACERLTVPHARYSERPFVLGPLVDLTGASETWRDATRDGLLEAQRIWQGMG
DEMAVMTSADMARVMPLRDSLWGWGRSTMVMGILNVTPDSFSDGGAHFGGVDAAVRHARA
MVAAGATIIDVGGQSTRPGATRVSTEEELGAKLFQVIRAFNVEFGKRSDVHVSVDTFYGA
VARTAADAGADIINDVSGGTWDKTMLPTVAALETPLPYVVMHVRGDPSDMQSAKNTTYDG
HVCDDVGDGLLATARRCVEHGIEPWRLWIDPGIGFAKTGRANMELLRDLPRVRSRLAPMG
GALVNAPMLIGASRKRFLGEIAGRAEASERDAASVAALVAAVHGGADIVRVHNVPLSSDA
SRVADALWRR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcctcgtccgtcgcgcctctcacttcaccgcgtccgcgcgcggcgatcgcacg
cgcgtcgtcatcgcgctcgggagcaacgagggcgatcgtgtcgcgctatttcgcgatgct
ttacgaagactcaggagtgacctggacttcaccctcgaggcgcattcgtcgctctacgag
accgcgcctgcgtacgtcgaggaccaagggcgattcttaaacgccgcatgcgtcgggacg
ttcccggactcgacgtctagagacccactgaagttactcgacgggctgaaatcgattgag
gcggctctgggacgggactttggcgggcgacgatacggaccgcggagcatggatttagac
gtgatatttcacggcgagggtgtgcacgcgtgcgaacgattgacggtgccgcatgcgagg
tacagcgagcgaccgttcgtgctcgggccgttggtagatttgacgggcgcttcagagacg
tggagggacgcgacgagagacggcttactcgaggcgcagagaatttggcagggcatgggc
gatgagatggccgtgatgacgagcgcagacatggcgcgagtgatgcctctacgagattcg
ttgtggggttggggacggtcaaccatggtgatggggattctaaacgtgacgcccgactcg
ttcagcgacggcggcgctcacttcggcggcgtggacgcagcggtgcgacacgctcgagcc
atggtcgccgcaggggcaacgataatagatgtgggtgggcaatcgacgagaccaggggcg
actcgtgttagtacagaggaagaacttggcgcgaagttattccaagtcataagagcgttc
aacgtagagtttggcaagcgctctgatgtccacgtctctgtggatacgttttatggcgcc
gtcgcgcgcaccgccgcggacgcaggggctgatatcatcaacgacgtcagtggaggaacg
tgggacaagaccatgctccccacggtcgcggcattagagacaccacttccatacgtcgtc
atgcacgtgcggggcgacccaagtgatatgcagagcgccaagaacacgacgtacgatgga
cacgtgtgtgatgatgtcggcgacggccttttggcgacagcgcgtcgatgcgtcgaacac
ggtatcgaaccgtggcggctttggatcgatcctggtatcggttttgcgaagacgggtcgc
gcaaacatggaactgcttcgagatttgccccgcgtgcggtcgaggcttgccccgatgggc
ggagctctggtgaacgccccgatgttgataggtgcatcccgtaagcgttttcttggagaa
attgccggaagggccgaggcgagtgagcgagatgctgcgtccgtcgcagcgcttgttgcg
gcggttcacggcggcgccgacatagtacgagtgcataacgtgccgctttctagtgacgct
tcgcgagtggcggacgcgctgtggcgtagatag

DBGET integrated database retrieval system