KEGG   Ostreococcus tauri: Ot06g03280Help
Entry
Ot06g03280        CDS       T01358                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ota  Ostreococcus tauri
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ota03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
6
AA seq 1984 aa AA seqDB search
MFALPAATPTVAAAGPIASTSEPSSTKSGDGSSPASRFQHLLSALRRLELGRVSERDRER
ARAALRLNEKRLREAVFFEPRRAEDAAKVTSGTVTLSHGLEVRLGELDVEHASKIAVALD
VNEIASVELIVGAIENGAPADDVVPSAVGIYMRERMAALESLLVVLRCADGSTPLDGGWF
AFRHLVKLVTAPPPGGPFLVAPQQPQAGALVLTNAPTQPVGRALGPMDKLFDIRGRPMLR
QECVAQERRLVVECLFHSARVSPSLSIENAQALLVLAGRSADAMKQLEKVAVEDVPTGYG
SIFAAAAMFTPVKSGVESAMTKMELAKGVLSAINSPNAPPLFSFIRFAWATLGLDLGLPE
AEESIRESLKNDGLEAIDLILKTGVFQDEHVAARSQNLMLVDTILSRYLHHNLRKTTLHR
MLTDGTGVRAPFVENGVTIEIDPAKPMADLCSVFSEIYTQKPEMADGCSNLKSFLEIAGD
SEHSVGSLVKLLDLCRTIAQTTEGSRRIFELLQRSQGAANWDRLLGALIGYVQRFMSSPD
DLLDAGEEYDPRDGEPEMNEADAEGLRAYLSVFKAVMEHAERTDAAHWLMWLEHRIGASL
MDALLQLYINPVPSSLKASLLDAISALCWDSNKASDVWQLLDQAGILPNPSQTGMLQTVQ
SQRCDILYIYSVVESQEQSYASTAAWLRLISKLLMITQDSELGPCSDACSPAWFHSRFIR
ERLFGELDTRVHKDQTERWRMARDCIDHFLFVLRTSENYPSISGMEDSGTPNIGAPLVIS
QGESSTALTIRNADQSQGVSDRSGTPGSDILLDFLTTGPTFRMVMNILSIGAEHLSFERN
APHGDALERCVLGSLQLLDYMMSIDVHAVRKLRVKNKEAFFYRTVDESLSADITLMANVL
GYVQYKYSAEIPLAALKILRVLCSRIDHIVLVLPPVSRAALVEGCASCLELAFAMPPPGE
GESIADENAQNAIECASLVFALLHENLTRPGTNLSHLLLGFDLTGASSEMALRPFSEFNC
LSVLFELLEAAPPSMHASVVLPFEAPELAADLLHRLATLKSTAPPVLALLQQWPPHAPSA
VLPDLLADALRTHLPDEPAKRRSVMHHRASILRLCAEVLDVESPPAKNRLPEMAPALVLD
IMTVLLDNGREGLSTYAHDVNVEHGQFAVLELPKSITHLSGAHHEHAITANFGPEILETM
EELSATQILDDSKQVSEGGIFAFNKRGDKIIDADVVRAKLQAECKRLESESNGYMVRQDA
VLVAKLQRERAIDACLQVVEARNTVVEDATARSETFVAWEQLLTTVVSRGLSSIVTAIEL
QRAVVTMANVPADEGPMSAHSIIFELVDGVLAGICEAEPFGGGSDVAKAVPFCRLVHTML
SHLRQRGEEDRSKNDTSVFLAPSKCRALLRSLIACLLHRSPLPQASRQDIINALLDYLAY
CRPDALGVSPVTKQGQTISGLSASFSQAADVDIEKANAAIIQRDATALVDVISRDALEGS
NDTKAVALAALEAMVTVCAHTGGGGIVVLLLQNGVAKACLRELERVSMPDLVLNTPRAAS
QMKAIEASLSLLMRMAQSEPGQMIALGTLTSLTNCRAIDAYADIHSASATMATMSVDKPY
SELPIPRARHHKLLVNVIRLARILLASDLQPKTPVSPVLAQYKGGVIESIGYPSVVAQVL
EFVEAHAAVIHRVLADRAPQPHLADLAELEVTVDLVTRLLKGGITPDPKLRLHGAIDVLT
AMICGAEANKYSKFISKTLGHAEADDDVMLASSDDAHAIDAAERMLARFINVRSMVLSAQ
RVLVNKGLTKFTFSVSDGVVGDERPTVHLFGTLVIELSGELDRLCRARKYALKSIEYGSI
LRTSDVSESDLVAKVASLEADIRTIVISAENSLEILYAHLHSLVQKGEDDSLVAPSAELS
GGNAKTHELGILASVMIPSLQALIEYDKLVLGLDTEFLNMIATRVRDTLAAPNSGSLRQR
FGIA
NT seq 5955 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctctgcccgcggcgacgcccaccgtggccgcggccggtccgatcgcgtcgacg
agcgaaccttcgagcacgaagagcggtgatgggagctcacccgcgtcgaggtttcagcac
ctcctgtccgccctgcgaaggctcgagctcggacgggtgagcgagcgcgatcgagagcgc
gcgcgcgcggcacttcgattgaacgagaagcgtctgcgagaggcggtgttttttgagccg
cgtcgagccgaggatgcggccaaggtgacgtcgggaacggtgacgctgagccacggactt
gaggtacgcctgggagagttggacgtggagcacgcgagtaagatcgcggtggcgctggac
gttaatgagatagcgagcgtcgagctcatagtaggcgcgatagagaacggggcgccggcg
gacgacgtggtgccgtcggctgtggggatttacatgcgcgagcgcatggcggcgctggag
tcgctactcgtcgttctgaggtgcgccgatggatcgacgccgctcgatggcggatggttc
gcttttcgacacctggtgaaactcgtcacggcgccaccgcctggcggaccgtttcttgtc
gcaccgcaacaaccacaggctggcgcgctagtgctcacaaacgcaccgactcaacctgtc
ggacgtgcgcttggtccgatggataaattgttcgacattcgcgggcgtccgatgttgcga
caagaatgcgttgcacaggagcgcaggttagttgttgagtgtttgttccactcggctcgt
gtttcaccaagcctgagcattgaaaacgcccaggcgcttttagttttagccggaagatcg
gctgatgcgatgaaacagctggagaaagttgcagtagaggatgtcccaaccggatacggc
tcaattttcgccgccgcggcaatgttcacacctgtcaaatcaggagtggagtccgcgatg
acgaagatggagctcgcaaagggtgtgctgtcagcgatcaattcgccgaacgcgccgcca
ctcttttcgttcattcgattcgcatgggccacgttgggtcttgatttggggttaccagaa
gccgaggaaagtattcgagagagtctgaagaacgatggcctcgaggccattgatctgatt
ctgaaaacaggcgtatttcaagacgaacacgtcgccgctcgatctcagaatctgatgctc
gtagatacaattctatcccggtacctgcaccataacctgcgtaaaacaacgttgcataga
atgctcactgacggcacaggtgtgcgggcaccttttgtggaaaatggagtcaccattgaa
atcgatccggcgaaacccatggctgatttatgctccgtattctcagagatctacacgcaa
aaaccagaaatggcggacggttgctcaaatttaaagagttttctcgagatcgcaggtgat
agcgagcactccgtcggctcactggtgaaacttttggatctttgcaggaccattgcgcag
acgactgaaggatcgagacgcatttttgaacttcttcaacgtagtcaaggcgcggccaac
tgggatcgtttgttgggtgcgctgattggttatgtacagcgtttcatgtcgagtccggat
gatttgttagacgctggagaagagtacgatccgagagatggggagcctgagatgaacgag
gcagatgccgagggattacgagcctatctgtccgtgttcaaggcagtgatggaacacgct
gagcgcacggacgctgcacactggcttatgtggctagaacataggattggagcgtcgttg
atggatgcgctgcttcagttatacatcaatccggttccgtcgtcactcaaggcgtcgctt
ctagacgctattagcgcactttgttgggattcgaacaaggcgtcggacgtttggcaacta
ctcgaccaggcaggtatattgccgaatccgtcacaaactggtatgttacaaacggtgcag
tcgcagaggtgcgatattctgtacatttactccgtggtcgaatcgcaggaacagtcgtat
gcgagcaccgcagcgtggctacgtttgatcagtaaactcttgatgataacccaagacagc
gaactcggaccttgctcggacgcatgcagtccagcatggtttcattctcgatttattcga
gagcgacttttcggcgaactagacacacgcgtgcacaaggaccaaacggagcgctggaga
atggctcgcgattgcatcgaccacttcctgtttgttctgcgaacgagtgaaaattatccg
tccatctctggtatggaagactcaggcacaccgaatataggtgctcctctagtcatcagt
cagggcgagtcttcaacagcattgacgatcaggaatgcggatcaatctcaaggtgtatct
gatcgatcgggcaccccaggctcagatatcctcttggacttcttaacgactgggccgact
ttcagaatggtgatgaacatcctttctattggtgcggagcatctgagtttcgagcggaat
gcgcctcatggtgacgcgttggagcgctgtgtattaggttctttgcagttgctcgactac
atgatgtcgattgacgtacatgcagtcaggaagctgcgtgtgaagaataaggaagcgttc
ttctatcgtaccgtggatgaatccttaagtgcagatattacgctgatggcgaacgtgctc
ggctatgttcagtacaagtatagcgccgagatcccgctggcggcgcttaaaattttgcgc
gttctctgtagccgaatagatcacattgtgctagtacttcctccggtctcgagagccgcg
ctggtggagggttgcgcaagctgtctggagctcgcttttgccatgcctcctccaggcgaa
ggtgaatcaatagcggacgagaacgctcaaaatgcgatcgaatgtgccagtttagtattt
gcgctgcttcacgaaaacttgacgcgtccgggtactaacctatcacacctgttattgggc
tttgatctcactggagcgtcaagcgagatggccttacggccgttttcagagttcaactgt
ttgagcgtactcttcgagcttttagaggcagctccgccctcgatgcacgccagcgtcgtc
ttaccgtttgaagctccagaactcgccgcagatttgttacaccgtctcgcgacgttgaag
tctactgcgccgcccgtattggcactgctccaacagtggccgccgcacgcaccaagcgca
gtgctaccagatttactcgcagatgcgcttcgtacgcatcttccagatgaaccggcgaaa
agaagatccgtgatgcatcatcgtgcaagtattttgcgtctgtgcgcagaagttctggac
gttgagtctcctccagcaaagaaccgcctgccagagatggcgccggcgcttgtattggat
atcatgactgttttgctcgataacggtcgagaaggcctcagcacgtacgcacacgatgtg
aacgttgagcacggtcagtttgcggtattagagctcccgaagagcatcactcatttatcg
ggggcgcaccacgaacacgcgattacagcaaactttggtcccgagatacttgagacgatg
gaggaactctcagcgacgcaaattttggacgattccaagcaagtgagcgagggtgggata
ttcgctttcaataaaagaggcgacaagattattgatgcggatgttgtgcgtgccaagctt
caggcggagtgcaagcggcttgaatctgaatcgaacgggtacatggtgaggcaagatgca
gtacttgttgctaaactccagcgcgaacgcgcaatcgatgcctgtctccaagttgtggaa
gctcgaaacaccgttgttgaggacgccacggcccgatcggaaacatttgttgcgtgggag
caactgcttaccaccgtcgtttccagaggattgtcgagcattgtcactgcaatagagctc
cagagagctgtggtgacgatggcgaatgtgcccgcagacgaagggccaatgagcgcccat
agcatcatattcgaacttgtggacggtgttctggccggtatctgtgaggccgagccgttc
ggaggtggttccgacgtcgccaaggccgtgcccttctgtcgactggtgcacacaatgctc
tcgcatcttcgccagaggggcgaggaagaccgttcgaagaatgatacgagcgtcttcctc
gcgccgtcaaagtgccgagccttgctgaggagtctcatcgcgtgcttactgcatcgctca
cctttacctcaagcgtcaagacaggacatcatcaacgccctacttgattacctggcatac
tgtaggcctgatgcgttgggcgtcagtccagtgacgaaacaagggcagacaatctctggg
ttgagtgcatccttttcgcaagcggctgacgttgatatcgagaaagcaaacgccgccata
attcagcgcgatgcgactgcgctggtggacgttatatctcgagacgctctggagggttca
aatgataccaaggcagttgccttggctgcgctcgaggcgatggtcaccgtgtgcgcacac
acaggtggcggtggcatcgtcgttcttctgctgcagaatggtgtcgctaaagcatgtctg
cgtgagctggagcgagtctccatgccagatttggtgctgaatacacctcgtgccgcctct
caaatgaaggccattgaggcgtctctttcgctgctcatgcgcatggcgcaaagcgaaccg
ggtcagatgattgcactgggaacgcttacttctttgaccaactgtcgcgcaatcgacgca
tacgccgacatccatagcgcttccgcgactatggcgacgatgtccgtggataagccatac
tcagagcttccgatccctcgagcgagacatcacaagctcctcgtgaacgtcattcgcctc
gctagaattctccttgcttcagatctgcagccgaaaacaccggtttcaccggtcttggcg
cagtacaaggggggcgttatcgagagcattggctatccatcagttgtggcgcaagttttg
gagttcgtcgaggcacacgcggcagtgatccaccgcgtactcgcggaccgcgcccctcaa
ccacacctcgctgatttggcagagctcgaggtgacggtcgacttggtgacgagattgctc
aagggtggcatcacaccggatccgaagcttcgtctgcacggtgcgatcgacgtgctcacc
gcgatgatttgcggcgccgaggcgaacaagtattcaaagttcatttcgaaaactttgggg
cacgctgaggcggatgatgacgtgatgcttgcttcctcggacgacgctcacgcgatcgac
gccgctgagcgtatgttggcacgattcatcaacgtccgaagcatggttctgagtgcgcag
cgcgtactcgtgaataaaggtctgaccaagttcacgttctctgtgtccgatggcgtcgtg
ggcgatgaaaggccaactgttcatctcttcggcacgctcgtgattgagctttcgggcgaa
ctcgatagactgtgtagggcgagaaaatatgcgctcaaatcaatcgaatacggctcaatt
ttgcgaactagtgacgtgagtgagtcagatttggtcgccaaggtggcctcgctcgaggcc
gacattcgtaccatagtgatcagcgctgaaaactcgctagagattttgtacgcgcacctt
cactcgttggtacaaaagggagaggacgacagccttgttgcaccctcggcggagctcagc
ggtggaaatgcgaaaacacacgagttgggcatattagcctcagtcatgattccgagcttg
caagcgctcatcgagtacgacaaattggtactcgggctagatacggagttcttaaacatg
attgccacgcgtgtcagggacaccctggcggcaccaaatagtggatcactgcggcaacga
tttggaattgcgtaa

DBGET integrated database retrieval system