KEGG   Ostreococcus tauri: Ot06g03600Help
Entry
Ot06g03600        CDS       T01358                                 

Definition
protoporphyrinogen IX oxidase (ISS)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ota  Ostreococcus tauri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ota00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
6
AA seq 533 aa AA seqDB search
MSRAQVSLAPARVADRRRVGRTRAARRAVAVRASTVERDVVIVGAGVSGLSTAFTLAKKT
MPNASVMVTEARDRVGGNITSKSDGTYTWEEGPNSYQPGDAILTLACDAGMRDDILLADP
ASNRYVLWDGKLRILPHSIESAVLGDFLTWPGKIRAGLGAIGIRPPAPGKEESVKEFVSR
NLGTEAFERLIEPFCSGVYAGDPASLSSVAATGRVQRLEPLGGSLVVGALKAQAEAAKAK
KESGFKRDPRLPEVKGQTVGSFRGGLKTFPEGLAKQLGDDVVKCNWKLVNVNKAAEGGYT
CEYDTPEGRRTVIAKCLLLTAPAYVTAEIVKDMAPAASTALNKFYYPPVASVTVSYKKDS
FRLDGTSALPEGGLTGFGQLHPRSQGIRTLGTIYSSSLFKDDKRQPDDEFMILNYIGGAR
DVAIKDLSEDELVQQVHEDALKTILKPGTPLPKVVGVKLWEKAIPQFNLGHLDVLAEAEN
ALEAAACGEKDGLFLGGNYTAGVALGRCVEFGVEQADEVATFLKSAKKLTAAV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgcgcaggtctcgctcgcgcccgcgcgcgtcgccgatcggcgccgcgtcggg
cgcactcgcgccgcccgacgcgccgtcgccgtccgcgcgtcgacggtggaacgcgacgtc
gtcatcgtcggcgcgggcgtcagtggtttgtccaccgcgttcacgctggcgaagaagacg
atgccgaacgcgagcgtgatggtgaccgaagccagagatcgcgtcggtgggaacattacg
agtaagagcgatggcacgtacacgtgggaggaggggccgaactcgtaccaacctggggat
gcgatcctcacgctggcgtgcgacgccggcatgcgggacgacatcttattggccgatccc
gcgagcaatcgatacgtgctgtgggatgggaaattgagaattttgccgcacagcatcgag
agtgcggttttgggggatttcttgacgtggccggggaagattcgagccggtttgggggcg
atcggaatcaggccgccggcgccgggtaaggaggagagtgtgaaggaattcgtgagcaga
aatctcggcacggaggcgttcgagcgattgatcgaaccattttgctcgggggtgtacgct
ggggatcccgcgagcttgagctcggtcgcggcgacggggcgagtgcagcgacttgaaccg
ctgggggggtcgctcgtggtgggcgcgctcaaggcgcaggcggaggcggcgaaggcgaag
aaggagagcgggttcaagcgcgatcctcgacttccggaagtgaagggtcaaaccgtaggt
tcgttccgaggtggtttgaagacatttccagagggattagcgaaacaactcggcgacgac
gtcgtcaagtgcaactggaagctcgtcaatgtcaacaaggctgccgagggcgggtacacg
tgcgagtacgataccccggaggggcgacgaacggttatcgccaagtgcttgttgctcacc
gctccggcgtacgtcaccgctgagatcgtcaaggacatggctccggcggcttcgacggcg
ctcaacaagttttactaccctccggtggcgtccgtgacggtttcgtacaagaaggactcg
ttccgtcttgacggcacttcagcgcttcctgagggtggtctcactggtttcggtcagctc
cacccgcgctcgcagggcatccgcacgctcggcacgatttactcgtcctcgcttttcaag
gacgacaagcgccagccggatgacgagttcatgatcttgaactacatcggtggcgcccga
gacgtcgcgatcaaggacttgagcgaagatgagctcgttcagcaagtgcacgaggacgcg
ctcaagacgatcctcaagcccggaacgccccttcccaaggttgtcggcgtcaagctgtgg
gagaaggccatcccgcagttcaacctcggccatctcgacgtcttggccgaggccgagaac
gcgctcgaggcggcggcgtgcggcgaaaaggatggtctctttctgggcggtaactacact
gccggcgtcgctctcggtagatgcgtcgaatttggcgttgagcaagccgacgaggtcgcc
acgttcctcaagtcggcgaagaagctaactgccgcggtttaa

DBGET integrated database retrieval system