KEGG   Ostreococcus tauri: Ot06g04190Help
Entry
Ot06g04190        CDS       T01358                                 

Definition
probable ThrC2 threonine synthase (ISS)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ota  Ostreococcus tauri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ota01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ota00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ota00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
6
AA seq 595 aa AA seqDB search
XXSFEDVCVEVLSPFVDDAFDREDVRAIAREVVSRHESGEVCNVRRLGRRGGREARVAEL
FRGPTLSAEDASMQMTMRMLDRVLARKNKRANVVCCSTGEAGGALASVAAEMTRVDAWIA
YPGDDGDVSEPQEREMTCHVEDNVHPIKVFECPDGVSDVDAVVSDVFADEQFRMAHGLVS
ANSSNIARVLSYVPIFFYIYARVRSREQDRGKPVVFTVPSSTFALEFAGSLARMMGLPIT
IVAACNANGAAHRVISMGELYKTDMVHTSSSALDVVVAENVWRSLYYAAGSNPMILSELQ
DDFDEDGEVALPPKMARELNTVFKSALIDDDLLFSVIQHEERLGFVPCPQTALAIAAIEM
IRDVPEDVPAVALAVSHPSKFPDVIRRAVPQLSNGASHPTVEAMTGLFHRRRTCTLEEFE
RSLRRDIAAVTAMRTPEPVRVERLLLEREDYERLYASVLRKTTKRGKFLDNPFVNVFLAL
MISFWATATTPPRDASRSRERDAQKAEAKAKRDKERVRVREARALEKQRAREISARAKAD
ARFAREMARAARAEEKRARAGAPTKPHVMHAYARDRDDARPPNEHFAHEPNRKLR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
nnnncatccttcgaagacgtctgcgtggaggtcctgagcccgttcgtcgacgacgcgttc
gaccgcgaggacgtccgagcgatcgcgcgtgaggtggtgtcgagacatgagagcggagag
gtgtgtaacgtgcgacgattgggacggcggggggggcgcgaggcgcgcgtggcggagctc
tttcgaggaccgacgctgagcgcggaggacgcgtcgatgcaaatgacgatgcggatgctc
gatcgggtgttggcgcggaagaataaacgggcgaatgtggtgtgttgctccacgggcgag
gctgggggggcgctggcgagcgtggcggcggagatgacgcgggtggacgcgtggatcgcg
tacccaggggacgacggcgacgtgagcgagccgcaggagcgagagatgacgtgtcacgtc
gaggataacgtccacccgatcaaggtgttcgagtgcccggatggtgtgagcgacgtcgac
gcggtggtgagcgacgtgttcgcggatgaacagtttagaatggcgcacgggttggtgagc
gcgaatagctccaacatcgcgcgggtgctgagctacgtcccgatattcttttacatctac
gcgcgagtgcggtcgagggaacaggatcgggggaaaccggtggtgttcaccgttcccagt
tccacgtttgcgctggagttcgcggggagcttggctcggatgatgggtttacccatcacc
atcgtcgccgcgtgcaacgccaacggagcggcgcaccgcgtcatctccatgggcgaattg
tacaagacggacatggtgcacacctcctcgagcgcgctcgacgtcgtcgttgccgagaac
gtgtggagatcgctgtattacgccgcgggttcgaaccccatgatcctgagtgagcttcag
gatgactttgacgaggatggcgaagtcgcgttgccgccgaaaatggcgcgagagttgaac
accgtctttaagagcgcgctcatcgacgatgatttactgtttagcgtcattcaacacgaa
gagcgcttggggttcgtcccgtgtccgcagaccgcgctcgcgatcgcggcgatagagatg
attcgggacgtccccgaagacgtccccgcggtggccttggcggtgtcgcatccgagcaaa
tttccagacgtcattcgtcgagccgtgccgcaactctcaaatggggcgtcgcaccccacg
gtggaagcgatgacgggcttattccatcgccgtcgcacgtgcacgctcgaggaattcgag
cgatcgctgcgcagagacatcgcggcggtgacggcgatgcgtacgcccgaaccggtgcgc
gtcgaacgcctcttgctcgagcgcgaggattacgagcgtctctacgcctccgtgctgagg
aaaacgacgaagcgtgggaaatttttggataatcccttcgtcaacgtcttcttagcgctg
atgatctcgttctgggccacggcgacgacgccgccgcgggacgcgtcccggagccgcgag
agagacgcccaaaaagccgaggcaaaggcgaagcgcgataaagagcgcgtcagagtgcgc
gaggcgcgcgcgcttgagaaacagcgcgcgcgtgaaatcagcgcgcgcgccaaggcggac
gcgcgcttcgcgcgagagatggcgcgcgccgcgcgcgccgaggaaaagcgcgcgagagct
ggcgcgccgacgaaaccgcacgtcatgcacgcctacgcccgcgaccgcgacgacgcgcga
ccgccgaacgaacacttcgcgcacgaacccaatcgcaaattgcgatga

DBGET integrated database retrieval system