KEGG   Ostreococcus tauri: Ot06g04370Help
Entry
Ot06g04370        CDS       T01358                                 

Definition
dihydrolipoamide S-succinyltransferase (ISS)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ota  Ostreococcus tauri
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ot06g04370
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ot06g04370
  Amino acid metabolism
   00310 Lysine degradation
    Ot06g04370
Enzymes [BR:ota01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ot06g04370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
6
AA seq 449 aa AA seqDB search
MDVVANRAIANRAIASGGRTRSREARWTSTTTETLVCVPSMGDSITEGTVSAVMKSVGDD
VATDEVVAQIETDKVTVDVRAPSAGNVARVDAKTGDTVRVGQVVMAFVPGAGGNGKKTAR
GGAFYGRLHHRGSVAALLVKAGQRVAMDEIIAQIETDKVTIDVRASTSGTVTEVATLAPG
PGPEARAETKAEGPKAVEAPKAAATPAPAPKAAGSRSETRVPMSRLRLRVAERLKSSQNT
YAMLTTFNEIDMTNVMNMRAEYKDSFLEKHGVKLGFMSTFVSAAAKALQEEPSVNAVIDG
DEIVYRNYVDISVAVSAPRGLVVPVLRNCESMTFADVEASIATYGKKAKDGTLSIDEMAG
GTFTISNGGVFGSLTGTPIINPPQSAILGMHSIVWRPVCVGPERTIAARPMMNVALTYDH
RLVDGREAVTFLKSIKESVEDPRRMLLKL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcgtcgcgaatcgcgcgatcgcgaatcgcgcgatcgcgtcgggcgggcgaacg
cgttcgcgcgaggcgcgatggacgtccacgacgacggaaacgctcgtgtgcgtgccgtcg
atgggtgattcgatcacggagggaacggtgagcgcggtgatgaaatcggtgggggacgac
gtcgcgacggatgaagtcgtggcgcaaatcgagacggacaaggtgacggtggacgtgcgg
gcgccgagcgcggggaacgtcgcgagggtggacgcgaagacgggtgataccgtgcgcgtg
gggcaggtggtcatggcgttcgtcccgggtgcgggaggtaatgggaagaagacggcgagg
ggaggtgccttctatgggcgactccatcaccgaggaagcgtcgccgcgttgctcgtcaag
gcggggcaacgggtcgccatggatgaaattatcgcgcagattgaaacggataaggtgacg
atcgacgttcgcgcgtcgacgagcgggacggtgacggaggtggcgacgctcgcgccgggg
ccgggaccggaggcgcgcgccgagaccaaggcggaggggcccaaggctgtggaggccccg
aaagcggcggcgacgcccgcacccgcgcccaaggcggcgggatcgcgatccgagacgcgg
gtgccgatgtcgcgtctgcgcctgcgcgtcgccgagcgcttgaagagctctcaaaacacg
tacgctatgctcacgacgttcaacgagatcgacatgacgaacgtgatgaacatgcgcgcc
gaatacaaggactcgttcttagagaagcacggtgtcaagttgggtttcatgagcacgttt
gtctccgccgcggccaaggcgcttcaggaggagccatccgtgaacgccgtcatcgacggc
gacgaaatcgtgtacagaaactacgttgatatatcggtcgccgtgagcgcgccgagagga
ctcgtggtgccggtgctgaggaactgcgagagcatgacttttgccgacgtcgaggcctca
atcgcaacgtacggcaaaaaggcaaaggacggcacgctctccattgacgaaatggcgggc
ggtacctttaccatctccaacggcggcgtgttcggatccctcaccgggacgccaatcatc
aaccctccacaaagtgcgattctcggcatgcactccatcgtgtggagaccggtgtgcgtc
ggtcccgagcgaaccatcgcggcgcgaccgatgatgaacgttgcgctgacgtacgaccac
cgcctcgtcgacggccgcgaagccgtgacatttttgaagtccatcaaggagtcggtggaa
gaccctcgtagaatgctgctcaaactttag

DBGET integrated database retrieval system