KEGG   Ostreococcus tauri: Ot07g02450Help
Entry
Ot07g02450        CDS       T01358                                 

Definition
Polymerase (ISS)
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ota  Ostreococcus tauri
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ot07g02450
   00240 Pyrimidine metabolism
    Ot07g02450
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Ot07g02450
   03410 Base excision repair
    Ot07g02450
   03420 Nucleotide excision repair
    Ot07g02450
   03430 Mismatch repair
    Ot07g02450
   03440 Homologous recombination
    Ot07g02450
DNA repair and recombination proteins [BR:ota03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      Ot07g02450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
7
AA seq 116 aa AA seqDB search
MTLERIPTRIRRRAWTDVRPVVARIGSRKKPRQRVASDGAREGDDDAWDASVERDARALK
TFDLTSAFGPCVGLTRVERWDRAASLGLDPPKVVLEILQRRPTTAAWRECVWHGRL
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgagagaattccgacacgaattcgacggcgcgcgtggactgacgtgcgcccg
gtcgtcgcgcgaatagggtcgaggaagaagccgcgtcagcgcgttgcgtcggacggcgcg
cgcgaaggggacgacgacgcgtgggacgcgtcggtggagcgagacgcgcgcgcgctcaag
acgtttgatctcacgagcgcgttcggaccgtgcgtgggattaacgcgcgtggagcggtgg
gatcgcgcggcgagtctcggtttggacccgccaaaggtggtgctggagatattgcaacgt
cgaccgacgacggcggcgtggcgtgagtgcgtgtggcacggacgactgtga

DBGET integrated database retrieval system