KEGG   Ostreococcus tauri: Ot07g02450Help
Entry
Ot07g02450        CDS       T01358                                 

Definition
Polymerase (ISS)
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ota  Ostreococcus tauri
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ota00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ota00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ota03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ota03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ota03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ota03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ota03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
7
AA seq 116 aa AA seqDB search
MTLERIPTRIRRRAWTDVRPVVARIGSRKKPRQRVASDGAREGDDDAWDASVERDARALK
TFDLTSAFGPCVGLTRVERWDRAASLGLDPPKVVLEILQRRPTTAAWRECVWHGRL
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgagagaattccgacacgaattcgacggcgcgcgtggactgacgtgcgcccg
gtcgtcgcgcgaatagggtcgaggaagaagccgcgtcagcgcgttgcgtcggacggcgcg
cgcgaaggggacgacgacgcgtgggacgcgtcggtggagcgagacgcgcgcgcgctcaag
acgtttgatctcacgagcgcgttcggaccgtgcgtgggattaacgcgcgtggagcggtgg
gatcgcgcggcgagtctcggtttggacccgccaaaggtggtgctggagatattgcaacgt
cgaccgacgacggcggcgtggcgtgagtgcgtgtggcacggacgactgtga

DBGET integrated database retrieval system