KEGG   Ostreococcus tauri: Ot07g03490Help
Entry
Ot07g03490        CDS       T01358                                 

Definition
putative beta-galactosidase (ISS)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ota  Ostreococcus tauri
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ota00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ota00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ota00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
7
AA seq 1692 aa AA seqDB search
MLYECNWEALVHWVLRCTGLRAVLKLYDCWVFRTSRILGLLLRLGEAGYAMFFDVYVREA
LHGVRIHLHATFKDSRSTFEKEQGTVGQIPDWENPTIVGRNRRYGVATLESKGTTYAFTD
EAEFVSFWRSGGCWERRLTLSNVRSLNGVWQFKLLSYPISLTGEYVAMDFSTNEWDSINV
PSNWQCEGWDRPIYTNFQYPFPLHPPVARTQSDYSSDNSRGHTKISAVNPTGVYRHSFNL
EDDWNAKHDKTYIVFEGVDAAFHVWVNEQSVGYSQDSKLAAEFDISRYIHSGVNQLVVHV
YRWCDGSYLEDQDQWWLSGIFRDVYLYRKCLSQISDYSFRTQCPDHQTGKWDVTVQAEIC
ETTEAYFKKVNKVLVLRLLYNNFVEIHQACLHDFRIHQKMPYLGTMHDACTEEVYLQTKV
HFSLEHIMEWSSESPTLYMLVISLETESGEVLDCEGCRVGFRTVRVENKQILINNRPVLI
QGVNRHEHCPVRGKAVSEKLMLDDILLMKHTNFNAVRTSHYPNHPRFYELCDEYGLYVVD
EANIETHGFEFGLHSTPYLANRPTWKNAYMARVTRMFARDKNHCSVIIWSLGNESGCGGA
HFAMYSWIKHNDQSRLVQYEGGGYKTPCTDIICPMYAPPLLCAQLASQPDWRPVILCEYS
HAMGNSNGGLHKYFDVFRNQTGVQGGFIWDLIDQGLQCSKDGVQYWGYGGDFGDEPNDKQ
FCINGLFFPDRTPHPASFEAKYLQQPLMITLQADQVQVHNRYAFTDLDQLKFHWCVVLDN
GYTLAAGNIHCIKVGPGMVANYDWVDLFPSVASLSQTATERRLTFDEWWVDITASFVEDQ
LWADSQMIIAKCQLMLPKRVTSVSKEPRLESRVRVERGCNRLTVDCRDSSYIFDTASGSL
VEFQFRGETLIDSGLAPCLWRAPTDNDNGGSIFSFAARWAHAGLNKLDEYKTSTSSRINE
HGCFQLLVQKSLGPTKRKLVCTLCTRYTVTRCGHLEVKCTFNFARNLPPLPRIGVSVTCP
KQLHQVEWLGLGPHENYLDRKTSAFLGRYGATVEELHVPYIVPCENGARQGTRWLSLGSS
ESTNKCLFTSKENFSFSASNFTDEELARRVHQHELQRAQSINIHLDAFHMGLGGDNSWFP
SVHPEFTSSITTKNYDFALKPNDNYCDFEDWIMPILDEMLREQNEEGVKWTCSKVIKRLG
LEINHEDSIFYWAAKNDIPCYCPALTDGSIGDMLYFHSYKNPGLVIDVVADVRAMNDESI
KVKRPRKTGIILLGGGVAKHHICNSNLMRNGADYAVFINTAQEFDGSDSGARPDEAVSWG
KITMDAKPVKLYVDATIAFPLLVAQTFKKNFQPRGPPARAPLLERCTHVDHTSLLIRTGS
KRKVQQTTQSATDLAAQTPTRADLEGWSAASTSGALSQSDVREFQRLGFLALTGWCTDDE
CAAMRNRASAIVRDFDPASHASVFSTTDQTRTTDEYFLASGNGVSCFFEEKALRADGTLT
VEKEVAINKIGHAMHDLDDVFRAFSRSDKVKRLMESLSMSKPTPVQSMYIFKQPSIGGEV
VPHQDSTFLNTSPATCIGIWLALEDCTVENGCLFALPGTPPVARVMTVDYPGGSRKIEFI
GANPTHDLDAAHALEVPAGTLVLLHGANVHFSRANTSAKSRHAYSVHFVSGDAAWKPTNW
LQRSNDFPFTPL
NT seq 5079 nt NT seq  +upstreamnt  +downstreamnt
atgctctatgaatgcaactgggaagctctcgtgcactgggtacttcggtgtaccggtctg
cgagctgtactgaagttgtatgattgctgggtttttcggacgtcaaggatattgggtctc
cttcttaggctaggcgaagctggttatgcgatgttctttgacgtttacgtacgagaagca
ctccacggggtacgaattcatttacatgcaacttttaaagactctcgctcaacgtttgaa
aaggaacaaggtacagttgggcagatacctgactgggaaaatcccacgatagtgggacgt
aatcgcaggtatggtgtggctacccttgaatcgaaaggcacgacgtacgcttttacagat
gaagccgagtttgtctctttctggcgaagtggaggttgttgggaacgccgactaactttg
agtaatgttcgttctctgaacggagtgtggcaatttaaacttttgtcgtacccgatatct
ttaacaggtgaatacgttgcgatggacttctcgacgaacgaatgggattccatcaacgtg
ccgtcaaactggcaatgtgagggatgggatcgacccatatacaccaacttccaatatcct
ttcccgctccacccaccggtcgctagaactcagagcgactattcaagcgataactcgagg
ggacatacgaagataagtgctgtaaatccaactggtgtgtacaggcactcatttaacttg
gaggatgactggaacgcaaagcatgataaaacgtacatcgtatttgagggagttgacgca
gctttccatgtctgggtaaacgagcagtcagtcggttactctcaagatagcaaactggcc
gcagagtttgacatttctaggtacattcatagtggagtcaatcagttggtagtacatgtc
taccggtggtgtgatggcagctatctggaggatcaagaccagtggtggctgagtggaata
ttcagagatgtgtatttatatcgcaagtgtctctcgcaaatttcagattatagttttcgc
acgcagtgcccggatcatcaaacaggcaaatgggatgtgactgtccaagcagaaatatgt
gagacgactgaagcatatttcaaaaaagtcaataaagttcttgtactccgtcttttgtat
aacaatttcgttgaaatacatcaagcatgtctgcatgactttcgtatccatcagaagatg
ccctatcttggaacaatgcacgatgcgtgtacagaagaagtttatctccagaccaaggtg
cacttcagtctagaacacatcatggaatggtcttcagaaagtccaacactttacatgctc
gtgataagtttagagacagaatcaggggaagtactagactgcgagggatgcagagtaggt
ttccgaactgtacgagtggaaaacaaacaaatcctcatcaacaacaggccagttcttatt
caaggtgtgaatcggcacgagcactgcccggtgcgaggcaaagcagtatcagaaaaactc
atgctagacgatattctcctcatgaaacacaccaattttaatgctgttcgaacatcgcat
tatcccaatcatccgcgtttttatgagttatgtgatgaatatgggttgtacgttgtcgac
gaggcaaatattgaaacacatggctttgagtttggattacattcgactccttatctcgca
aatcggccaacttggaaaaacgcttacatggctcgagttacgagaatgtttgcaagagac
aaaaatcactgctctgtcatcatttggtcactcggaaacgagtcagggtgcggtggcgcg
cattttgccatgtactcctggataaaacacaatgaccagtctcgtctcgtccagtacgag
ggagggggctataagacaccttgtacagacatcatctgtcccatgtatgcgcctcctttg
ttgtgtgcacaactggcgtcacaaccagattggcggccagtgattttatgtgaatactcc
catgctatgggcaatagcaacggcgggctgcataaatattttgacgtgtttcgaaaccaa
acaggcgtgcaagggggatttatttgggacctgatcgatcaggggcttcaatgctccaag
gatggagtacaatattggggatacggtggagattttggcgacgaaccaaatgataaacag
ttctgtatcaatggtttatttttccccgatcgaacacctcatccagcctcgtttgaggcg
aagtatctccagcagcctttgatgataactctgcaagcagatcaagtgcaggttcacaat
cgctacgctttcacggatcttgatcaactgaagttccattggtgtgttgtcctcgataat
ggctatacacttgcagctggtaacattcactgcatcaaagtgggccctggaatggttgca
aattacgattgggttgatcttttcccgtcagtggcatcattgtcacaaacagctacggaa
agacgcttaactttcgatgagtggtgggtcgacatcactgcctcgtttgttgaagaccaa
ctatgggcagactcgcagatgatcatcgcgaagtgccagctaatgttaccaaagcgcgtc
acgagcgtctcaaaagaacccaggctggagagcagagttcgcgtggaaagaggctgcaat
cgattgacggtagattgccgcgatagctcctacatatttgacaccgcttcgggcagttta
gttgagtttcagtttcgtggcgagacgctgattgattcaggactcgccccatgcctttgg
cgcgcgcctacagataacgacaatggaggttccattttttcgtttgctgcgcgctgggca
catgcaggtttgaataagttggatgaatataagacgagtacaagcagccgcatcaatgag
cacggttgtttccagctattagtgcaaaagtctctcggacccaccaagagaaaacttgtt
tgcactttgtgtactcgctacaccgtcactagatgcggtcatctagaagttaagtgcact
ttcaactttgcacgaaatctgccaccacttccaagaataggtgtgagcgttacgtgcccg
aaacaacttcatcaggttgagtggcttggacttggtccacatgaaaattatctggatagg
aagacgtcagctttcttagggcgttatggtgctacagttgaagaattgcatgttccttac
atagtcccgtgtgaaaatggagcacggcaagggacacgctggctatctttaggatcgtca
gaaagtacaaacaagtgcctcttcacgagcaaggagaacttttcgttcagtgcgtcgaac
ttcactgatgaagagcttgcacgccgtgtacatcaacatgagctgcagcgcgcacaaagc
atcaatatacatttggacgcttttcatatggggcttggaggagataacagctggtttccg
agtgtgcacccagaatttacatcatctataacaaccaaaaattatgattttgccttaaaa
ccgaatgacaactattgcgattttgaggactggatcatgccgatcttggacgagatgctt
cgagagcagaacgaggagggagtgaagtggacgtgctcgaaggtgatcaagcggctcggg
ctggagattaatcacgaggattccatcttttattgggcggcgaagaacgacatcccgtgc
tactgcccggcgctcaccgacggctccatcggggacatgctgtatttccactcttacaag
aaccccggactcgtgattgatgtcgttgctgacgttcgtgcgatgaacgacgagtctata
aaggtgaaacgtccgagaaagacgggcatcatcctcctcggcggtggcgttgccaagcac
cacatttgcaacagcaacctgatgcgaaacggtgccgattacgccgtgttcataaacacg
gcgcaggagttcgacggcagtgactccggtgcgcgtcctgacgaggccgtgtcctggggt
aagatcacgatggacgccaaaccggtcaaactctacgtcgacgccaccatcgcgtttccg
ctcctcgtcgcgcagacgttcaagaaaaattttcaaccgcgaggtccccccgcgagggcg
ccgctcttggagcgatgtacacacgtagaccatacatccttgttaatacgtaccggtagc
aaacgaaaagtgcaacaaacaacacaaagtgcaacagatctcgcggctcagacccccacg
cgcgcggacctcgagggttggtccgcggcctcgacgagcggcgcgttgtcccagagcgac
gtccgagagtttcaaaggctcggcttcctggccctcactggatggtgcaccgacgacgaa
tgcgcggcgatgcggaatcgagcgagtgcgatcgtcagagatttcgatcccgcgtcgcac
gcgagcgtgttcagcacgacggatcagacgcggacgacggatgaatattttttggcgagc
ggcaacggcgtgagctgtttctttgaggaaaaagcgctgcgcgcagacggcactctgacg
gtggagaaggaggtggcgatcaataagattggacacgcgatgcatgatttggacgacgtg
tttcgcgcgttttcgagatcagacaaagtcaaacgactcatggaatcattgtcgatgtcg
aagccgacaccggtgcagtcaatgtacatcttcaaacaaccgagcatcggcggcgaggtc
gtcccgcatcaagacagcacctttttgaacacatcgccggcgacatgcatcggaatctgg
ctcgcgctggaggattgcacggtggaaaatgggtgtctctttgcgcttcctggaacgccg
ccagtggcgcgcgtcatgactgtggactaccccggtggctcgcgaaagattgaattcatc
ggcgcaaatccgacgcacgacctcgacgccgcgcacgcgttggaagttccggccggaacg
ctcgtcctcctccacggtgccaacgtgcacttctcccgagcgaacaccagcgcgaagtcg
cgccacgcttacagcgtccatttcgtctccggcgacgccgcgtggaagcccaccaattgg
ctccagcgctcgaacgatttccctttcacccctttgtaa

DBGET integrated database retrieval system