KEGG   Ostreococcus tauri: Ot07g04430Help
Entry
Ot07g04430        CDS       T01358                                 

Definition
Lysophospholipase (ISS)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
ota  Ostreococcus tauri
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ot07g04430
Enzymes [BR:ota01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Ot07g04430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
7
AA seq 227 aa AA seqDB search
MSGTTHPAPIVVEPRNGAADSAFIMLHGLGDTGHGWAGAATQIPSRGAARVRWIFPTART
VPVTLNGGMRMTAWFDLNALDEASIVDDRKMIEESAAYVDALVREQIAKGIPSEKIVVGG
FSQGGVIALTAALRSEVKLAGCVALSTYLALREDYPGKFGPHAKDTKILQGHGTHDMVLQ
YQYGKKSAEYLQSLGLSVDFKTYAGMQHSACAEEFDDLSDYLKTVLA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggaccacgcacccggcgccgatcgtggtcgaaccgcggaacggcgcggcggat
agcgcgttcataatgctccacggattaggggacacgggacacggatgggcgggcgcggcg
acgcagattccgtctcggggcgcggcgcgcgttcggtggatctttcccacggcgcgaacg
gtgccggtgacgctgaacggggggatgcgcatgacggcgtggtttgatctcaacgccctg
gacgaggcgtcgatcgtggacgatcggaagatgatcgaggagagcgcggcgtacgttgac
gcgctcgtgcgagagcaaatcgccaaaggcatcccgagtgaaaagatcgtcgtcggtggg
ttctctcagggaggtgtcatcgcgctcaccgcggcgctgcgttcggaggtcaaactcgcg
gggtgcgtcgcgctgtccacgtatctcgcccttcgcgaggactatccgggaaaatttggc
ccgcacgcgaaggacacgaagattttgcaagggcacggcacgcacgatatggtgttgcag
taccagtacgggaagaaatccgcggagtacttgcaatcactcggcctgagcgtggatttc
aagacgtacgcggggatgcaacactcggcgtgtgcggaggagtttgacgacttatccgac
tacttgaagactgtgttagcctga

DBGET integrated database retrieval system