KEGG   Ostreococcus tauri: Ot08g00440Help
Entry
Ot08g00440        CDS       T01358                                 

Definition
Glutathione peroxidase, mitochondrial precursor (ISS)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ota  Ostreococcus tauri
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ota00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ota00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
8
AA seq 179 aa AA seqDB search
MGAFQSKRPSSVIDACDTFDQLPSEPLHDGTAFDFASTRGGVVLVVNVASYCGLTTKNYE
DFKLLQDRFGDDLTILAFPCNGFMFQEPFGAKSACAFARKRGFKGMVFQKVKVNGSGASE
TFKWLKSRAGVRRIEWNFGKFLIDRDGKVRGYYPPQTRPRVFEGDVEALIGEKATEALA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgtttcagtccaaacgcccctcgagcgtcatcgacgcctgcgacaccttcgac
caactcccgagcgagcccctacacgatggcaccgctttcgacttcgcctccacgcgcggc
ggcgtcgtgctcgtcgtcaacgtcgcgtcgtactgcggtttgacgacgaaaaactacgaa
gatttcaagctcttacaggacagattcggtgacgacttgacaatcttggcgttcccgtgt
aacgggttcatgtttcaagagcctttcggggcgaaatccgcgtgcgcgttcgcgcggaag
cgagggttcaaggggatggtgtttcaaaaggtgaaggtgaacgggagcggcgcgagcgag
acgttcaagtggttgaagtcgcgcgcgggggtgagacgaatcgagtggaactttgggaag
tttctgatcgatcgtgacgggaaagtacgggggtattacccgccgcagacgcgaccgaga
gtgttcgagggcgacgtcgaggcactgattggtgaaaaggcgacggaggcgctcgcgtag

DBGET integrated database retrieval system