KEGG   Ostreococcus tauri: Ot08g00670Help
Entry
Ot08g00670        CDS       T01358                                 

Definition
LOC495685 protein (ISS)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ot08g00670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
8
AA seq 252 aa AA seqDB search
MLTRPASSRAFTRRALISASAMAWRSHGVDNQDLVRALTANAIVRHKRVKEAMLLVDRGR
YVPKNEMQSAYEDRPLAIGHGATISAPHMHAACLELLETRVRAGSRVLDVGSGTGYLSAC
LASMASERGEVVGVEHIEELVETSIENVRADGKSAWLANGRLTLRCGDGRLGYPEKAPYD
AIHVGAASREVPRALIDQLAIGGRLVIPVGDEGGQALMVIDKLEDGSLMKKMEMGVVYVP
LTDRESQLKRWF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgctgactcgccccgcgtcgtctcgcgcgttcacccgccgagccctcatctccgcctcc
gcgatggcctggcgctcgcacggcgtggataaccaagacctcgttcgcgccttgaccgcg
aacgccatcgtccgccataaacgcgtcaaggaggccatgttactcgtcgaccgaggtcgt
tacgttcccaagaatgaaatgcaatccgcgtacgaagaccgcccgctcgcgatcgggcac
ggcgcgacgatatccgcgccgcacatgcacgcggcgtgtttggaactcctggagacgcgc
gtgcgagcgggctcgcgggtgctggacgtcggaagtgggaccgggtatctcagcgcgtgc
ttggcgtcgatggcgagcgaacgaggcgaagtggtcggcgtcgaacacatagaggagtta
gtcgagacgtcgatcgagaacgtgcgagcggatggaaagagtgcgtggttggcgaacggg
cggttgacgttgcgatgtggagacgggcggttggggtatccggagaaggcgccgtacgac
gcgattcacgtcggcgcggcttcgagggaggttccgagggcgctgatcgatcagttggcg
atcggtggacggttggtgataccggtcggggatgagggtgggcaggcgctcatggtgatc
gataagctcgaggacggcagtctgatgaagaagatggagatgggggtcgtgtacgtaccg
ctcacagatcgcgagagccaactcaagcgctggttttga

DBGET integrated database retrieval system