KEGG   Ostreococcus tauri: Ot08g01240Help
Entry
Ot08g01240        CDS       T01358                                 

Definition
phosphoinositide-specific phospholipase C (ISS)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ota  Ostreococcus tauri
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ota00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ota04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
8
AA seq 616 aa AA seqDB search
MGLACVACETARGTAEHGWDLSRASFNPEFDARAVFIDGSDANANDDGRGVSGECAGDVC
AMWLERARGLDANAIERILSQCETTESGMVRAVDVLRRSGALDEGNFPFAPTETDESEMT
SEMSAYFVNSSHNTYLDGDQLFSRASVAAIAGALDRGCRVIELDVYDGKKRGDKPRPIVT
HGGTAVRPMYFEDAIKVIAERAHVASEYPVIVTLENHASKETRAEMSRILRSTLGDKLWA
PKSAVAGNQLKRWPSPLELKGRVIVRDKIKHKQDELQRRRDQRRGLCGLCGTKKQSKQRK
VLPKSLNVRKNDKVCAMQSIIEFPRSSTGVFDEGAVSSSSSDSEGEQDDEDLKRIVSVPN
VKFRSFHEARDVPRFSCSWSERKLKLKIEKESSKDIIEFTNAHLLRTYPAGHRIFSNNYD
PSEAWDVGASFVALNFQALDRYVWANRAKFRVNGNCGYVKKPAYLLDPTIERPSKPRRLQ
VKVFAGIGWDNFKDADRFSPPDSLIRITTLGCLADRTKPGKSNRTSVYSKARAGPEAQPV
WNDTFELAIFEPELALMQIQALDKDGNGDELLAHYDFPISKLREGVRIVPMLNRDDEFIH
DKISCAGVLMSFKWLD
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcgcgtgcgtcgcgtgcgagaccgctcgagggacggcggagcacggatgggat
ctctcgcgcgcgagttttaaccccgagttcgacgcgcgcgcggtgttcatcgatggctcg
gacgcgaatgcgaatgacgatggacgcggggtctccggggaatgcgcgggcgacgtgtgc
gcgatgtggttggaaagggctcgtgggttggatgcgaacgcgattgagaggatattatcg
cagtgtgagacgacggagtcggggatggtgcgggcggtggacgtcttgagacgaagcggc
gcgctggacgaggggaactttccattcgcgccgacagagacggatgagagcgagatgacg
tccgagatgtcggcgtacttcgtgaactcgagccacaatacgtatttggatggcgatcag
ttgttttccagggcgtcggtcgcggcgatcgcgggagcgctcgatcgggggtgtcgagtg
attgagctcgacgtgtacgacggaaagaagcgaggcgataagccgagacctatcgtgacg
cacggggggacggcggtgcgaccgatgtattttgaggacgcgattaaggtgatagccgag
cgtgcgcacgtggcgagcgagtatccggtgatcgtgacgcttgagaatcacgcgagtaag
gagacgcgcgcggagatgtcgcgcattctgcgcagcacgctcggagacaagctttgggcg
ccaaagagcgcagtggcggggaaccagttgaaacgttggccctcaccgctcgagttgaag
ggccgcgtgatcgttcgggataaaatcaagcacaagcaagacgagcttcagaggagacgt
gatcagagacgcggcttgtgtggcttgtgcggcacaaagaagcaatcgaagcaacgaaag
gtcttgcccaagtctttgaatgtgcgaaagaatgacaaggtttgcgcgatgcagtcgatt
atcgagtttccgcggtctagcaccggcgtattcgacgaaggcgctgtgagttctagctcg
agcgatagcgaaggtgagcaagacgatgaggatctcaagagaatcgtatccgtaccgaac
gtgaagttccgcagctttcacgaggcaagggatgtcccgaggttctcgtgtagttggagc
gagaggaaactgaagctgaagatcgagaaggaaagttcaaaggatataatcgaattcacc
aacgcgcacttgttgcgcacatacccagccggtcacagaatcttcagcaataactacgac
ccaagcgaggcgtgggacgtgggcgcttccttcgtcgctttgaactttcaagcactggat
cggtacgtgtgggcaaacagagcaaaattccgcgtcaacggcaactgcggctacgtgaag
aaaccagcgtatttgctagatcccacgatcgagcgtccgtcaaagccgagaaggttacag
gtgaaagtgttcgcgggaatcggttgggacaacttcaaggatgccgacagattttcgccg
ccggattccttgatcagaatcacgacgctcgggtgcttggctgatagaacaaagccagga
aaatcgaatcgaacgagcgtgtactcaaaggcgagagctggtccggaagctcaaccagtg
tggaacgacacgtttgagctcgcaatcttcgagcctgagttggcattgatgcaaatacag
gcactggacaaagacggaaatggagatgagctcttggcgcactatgatttcccgatcagc
aaattgcgagaaggcgtgcgcatcgttcccatgctcaaccgtgacgacgagttcattcac
gacaaaatatcgtgcgccggggttctcatgagtttcaagtggctcgactag

DBGET integrated database retrieval system