KEGG   Ostreococcus tauri: Ot08g01890Help
Entry
Ot08g01890        CDS       T01358                                 

Definition
histone H2B (ISS)
Orthology
K11252  
histone H2B
Organism
ota  Ostreococcus tauri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
8
AA seq 125 aa AA seqDB search
MDHDSIVTTTFKMAGKKPAQKKPSGAKKGGRKSKTETYKIYIYKVLKQVHPDTGISSKAM
SIMNSFINDIFEKIATEAAKLARYNKKPTVTSREIQTAVRLILPGELAKHAVSEGTKAVT
KFTSA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggatcatgactcaatagtgaccactacattcaaaatggccggtaagaagcccgctcaa
aagaagccgtccggcgccaagaagggtggccgcaagtccaagacggagacctacaagatc
tacatctacaaggtcctcaagcaagtgcacccggacaccggcatctcctccaaggccatg
tccatcatgaactcgttcatcaacgacatcttcgagaagatcgcgaccgaagccgccaag
ctcgcgcgatacaacaagaagccgaccgtcacctcccgtgaaatccaaacggctgtccga
ctcatcctcccgggtgaactcgccaagcacgccgtctctgaaggcaccaaggctgtcacc
aagttcacctccgcgtaa

DBGET integrated database retrieval system