KEGG   Ostreococcus tauri: Ot08g01910Help
Entry
Ot08g01910        CDS       T01358                                 

Definition
Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) (ISS)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ot08g01910
Transcription machinery [BR:ota03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Ot08g01910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
8
AA seq 417 aa AA seqDB search
MDAMTEDEPSSKRVREETPGKRVNGDASGTPERGDKAKYESDAKPSTASPTSPVRGAYAT
RESHLRKQERDGELKWEVITNDGVERHSKHLVALKNIFSKQLPNMPKEYIVRLVFDSRHK
SMLCMKNGNVIGGITYRPFPKQRMGEIAFCAISANEQVKGYGTRLMNHIKEYAKETENMT
HLITFADNNAVGYFQKQGFTKEIMMEREKWNGYIKEYDGGTIMECQLDGQVSYVDFVNQI
REQRKAVEAKVREMSTAHKVYNGLKDHFKPSADGKYTPIDVKHIKGLKEAKWERTGLPKF
RLVHPGCGDGLPTKENMHKFMRAIVNIVQAHADVWPFGGPVNPIEVPDYYEVRVASGNYY
VSLEMFCADFRLMFNNCRLYNSPDTVYFKCANRLETFFESKIAAGINWKVREPPTKR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatgacggaggacgagccctccagtaagcgcgtgagggaggagacgcccggg
aagagggtaaacggagacgcgagcgggacgccagaaagaggagacaaggcgaagtacgag
agcgatgcaaagccgtcaaccgcgtcgccgacgtcgccggtgagaggtgcgtacgcaacc
agagagtcacacctgaggaagcaagagcgagacggtgagctcaagtgggaggttattacg
aatgacggcgttgagcgccactcaaaacacttggtggcgctgaagaacatttttagcaag
cagttgccgaacatgcccaaggagtacatcgtgcgattggtgttcgattcgaggcacaaa
tcaatgttgtgcatgaaaaacgggaacgtgatcggtgggatcacgtacaggccgttcccg
aagcagcgcatgggggaaatcgctttttgcgccatcagtgcaaacgaacaggtcaaggga
tacggcacgcgattgatgaatcacatcaaggagtacgccaaggaaacagagaacatgacg
catttgatcacgtttgctgataacaacgcggtcggatacttccaaaagcaaggcttcacg
aaggaaatcatgatggagcgggagaagtggaatgggtacatcaaggagtacgatggcggg
accatcatggagtgccaacttgatggacaggtctcgtacgtggactttgtgaaccagatt
cgagaacaacgcaaggcggtggaggcgaaggtgcgagagatgagcacagcgcacaaggtt
tataacggcctgaaggaccatttcaagcccagcgccgacggcaagtacacgccgatcgac
gtgaagcacatcaagggcctgaaggaggcgaagtgggagcgcaccggcctgccaaagttc
cgattagtccaccctggatgcggcgatggattgccgacgaaggaaaatatgcacaaattc
atgcgagcgatcgtgaacatcgtgcaggcgcacgcggacgtgtggccgtttggcggtccg
gtcaacccgattgaagttccggattattacgaagtccgcgtcgcctcgggaaactactac
gtctcgctagagatgttttgcgccgatttccgcctgatgttcaacaactgccgcctgtac
aactccccggacacggtgtacttcaagtgcgccaaccgtctcgagaccttcttcgagtcc
aaaatcgccgccggcatcaactggaaggtgcgcgagccccctacaaagcgatga

DBGET integrated database retrieval system