KEGG   Ostreococcus tauri: Ot08g03350Help
Entry
Ot08g03350        CDS       T01358                                 

Definition
glutathione peroxidase (ISS)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ota  Ostreococcus tauri
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Ot08g03350
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Ot08g03350
Enzymes [BR:ota01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Ot08g03350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
8
AA seq 214 aa AA seqDB search
MLTQRAVVAPARLARARSRTRGLARGARAQTNASQTIHDFTLKTLGGGTREAPTEGADLP
LSQYKGKVVLINNKYGDDLVILGVPCNQFGHQCYDKDFELLNTLKYVRPGNGYEPKFQIT
GKMTINGEDEDAFWTFLKRAIPYPADDNGGRGDDFIYNTQPNSMPLQWSPVRRSDVVWNF
EKFLIGKDGKPAKRYSPKFENANLTADIDALIKA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgctcacccagcgcgccgtcgtcgcccccgcgaggctcgcgcgcgcgcgttcgcgcacg
cgtggcctcgcgcgcggtgctcgcgcgcaaaccaacgcgtcccaaaccattcatgacttc
acgctgaagacgctcggtgggggcacgcgcgaggcccccaccgagggcgcggacttgccg
ctgtcgcagtacaagggcaaggtggtgctgatcaacaacaagtacggggacgacttggtg
attttgggcgtcccgtgcaaccagttcggacatcagtgctacgataaggactttgaattg
ttgaacacgctcaagtacgtccgaccggggaacggatacgagccgaagttccaaattacg
ggtaagatgaccatcaacggggaggatgaggatgcgttttggacgtttttgaagcgcgcg
attccgtacccggcggacgacaacggaggacgcggggatgatttcatctacaacacgcag
ccgaactccatgccgctccagtggtcgcccgtgcgaagatccgacgtcgtgtggaacttt
gaaaagttcttgatcggcaaggatggtaagccggcgaagcgatactcgcccaagtttgag
aacgccaacctcacggcggacatcgacgcgctcatcaaggcgtaa

DBGET integrated database retrieval system