KEGG   Ostreococcus tauri: Ot09g01570Help
Entry
Ot09g01570        CDS       T01358                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ota  Ostreococcus tauri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
9
AA seq 285 aa AA seqDB search
MTLASPAIARGGTPTVEERFAATRGDVRKLMAEDPDFGPTMVRLAWHSSGTYDRMSRTGG
SGGGTIRFREELAHGGNAGLEAAIRKLEPIHERRDGISWADLIAFVGVVAIEEMGGPKLK
FSYGRVDEMDPGAVTPDGRLPDADKGDGPGPKTRQGLRDVFYRMGFNDREIVALSGAHAL
GRCHANASGYEGPWSGTPLLFNNSYFVLLKGLKWEPDDTKAKFQYTDPSGQLMMLPSDIA
LIEDEKFKPYVLEYAKSQTKFFEDFAAAFEKLETLGTSGLTPLNA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgcgtcgccggcgatcgctcgcggtgggacgccgacggtggaggaacggttc
gcggcgacgcgcggcgacgtgcgaaaattgatggcggaggatccggatttcgggccgacg
atggtgcggctcgcctggcacagctctggcacgtacgatcgaatgtctaggacgggcggg
agcggtggtgggacgattcgattccgcgaggagctcgcgcacggcgggaacgccggactg
gaagcggcgattcgtaagctcgaaccgattcacgagcgacgcgacggcatctcgtgggcg
gatctcatcgccttcgtcggcgtcgtcgcgatcgaggagatgggcggaccgaagctcaaa
ttttcgtacggtcgcgttgacgagatggatccaggtgcggtgacgcccgacggacgattg
ccagacgccgataagggcgatggtcctggaccgaaaacgagacaaggcttgcgcgatgtc
ttttatcgcatgggcttcaacgatcgtgagatcgttgcgctttctggtgcgcacgcctta
gggcgttgccacgctaatgcgtccggatacgaaggcccttggtcgggcacccctttgctc
ttcaataattcgtatttcgtattgctgaaaggcctgaaatgggaacctgacgacacgaag
gcaaagttccaatacaccgacccaagcggacagttgatgatgcttccgtcggatatcgcg
ttgatcgaggacgagaagttcaagccctacgtcctcgaatacgcgaagagtcagaccaag
ttctttgaagatttcgcggcggcgtttgaaaagcttgaaactctcggcacgagtggtctc
acaccgctaaacgcataa

DBGET integrated database retrieval system