KEGG   Ostreococcus tauri: Ot09g01610Help
Entry
Ot09g01610        CDS       T01358                                 

Definition
Histone acetyltransferase (MYST family) (ISS)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ot09g01610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
9
AA seq 438 aa AA seqDB search
MAMKEIDGGDAEDVDGGRFRVGANVWATASFDGKSRRAEIVDASIDESTGGVTSYYVHYC
ELNKRCDEWVEAGRVRARAEDGRNGGASASASGGELLGGDEKISGEGVVAPKTLTRNSKR
RYNEIHNVDAPVEDLPPLDQVYERMREERTKVKNVHSVEIGRHEMDTWYYSPYPDDFGKC
SKLYLCQYCFKYMRKAKTLMKHRDECELKHPPGKRVYRHPQGKEKPVLSFWEIDGAHFKM
YCQNLCLMAKLFLDHKTLYFDVEPFMFYVLTESTDGDKTHDVVGYFSKEKVSVDEYNLSC
ILTLPAYQRKGYGSFLISMSYELSRRQGIYGTPERPLSDLGQVSYRSYWSRFVLDALHKN
RGNLSVKDLSTMLMFREADIVSALQSLNLVKYWKGQHIISSSPKIVEEHLRSFEKKSAIA
GSHLEFNPEFLKWTPPKR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaggagatcgacggcggcgacgcggaggacgtcgacggcgggagattccga
gtcggggcgaacgtgtgggccaccgcgtcgttcgatgggaagtctcgacgagcggagatc
gtcgacgcgtcgatcgacgagagtacggggggtgtgacgtcgtattacgtgcactattgc
gaacttaataagcgatgcgacgagtgggtggaggcggggcgagtgcgcgcgcgcgcggag
gacgggaggaacggtggggcgagcgcgagcgcgagcgggggtgagctgttgggtggcgat
gaaaagatctcgggtgaaggcgtggtggcgccgaagacgctgacgaggaattccaagcgg
cgatataatgagattcataacgtcgacgcgccggtggaggatttaccgccgttggatcaa
gtgtacgagcgcatgcgcgaggagcggacaaaggtgaagaacgtgcactcggtggaaatt
gggagacacgaaatggatacgtggtattactcgccgtacccggacgatttcgggaagtgc
tcgaagttgtacctgtgccagtattgcttcaagtacatgcgcaaggcgaagacgttgatg
aagcaccgagacgagtgtgagttgaagcatccaccggggaagcgcgtgtatcggcaccct
cagggtaaggaaaaacctgtgctgagcttttgggagattgacggcgcacatttcaagatg
tactgtcagaacttgtgcctcatggcgaagctattcttggaccacaagacgctatatttt
gacgtcgaacccttcatgttttatgtcctcaccgagtcaacggacggcgataaaacgcac
gacgtcgtagggtactttagcaaagagaaagtgtcggtggacgagtacaatctttcgtgc
atcctgaccctgccggcgtaccagcgcaagggttacggctcttttttgatttcgatgagc
tacgagctgagccgacgacaagggatctacggcacacccgagcgtccgctttctgatctt
ggacaggtgagctaccgaagttattggagtcgatttgtcctcgacgcgttgcacaaaaac
cggggtaatctgagtgttaaagatttaagcacgatgttgatgtttcgcgaggcagatatc
gtcagcgctctgcaatcgctcaacctcgtcaagtactggaaaggacagcacataatatct
tcttcgcccaagatcgtggaggaacacttgcgaagctttgaaaagaaatccgccattgct
ggttcacatttagaattcaatccagaatttctcaaatggacacccccgaagaggtga

DBGET integrated database retrieval system