KEGG   Ostreococcus tauri: Ot09g03460Help
Entry
Ot09g03460        CDS       T01358                                 

Definition
MGC53924 protein (ISS)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ota  Ostreococcus tauri
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ot09g03460
  Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    Ot09g03460
Enzymes [BR:ota01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     Ot09g03460
Exosome [BR:ota04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Ot09g03460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
9
AA seq 227 aa AA seqDB search
XXKPADVIPYVERKARRGDPASVLRAYDAFGRKYPTYKLGAEKSALYGNEVLDTIEDLRC
VVEIGTFLGYSAIATAMRFRDPAARMLCVEFEERHADVARWAIDYAGLSDRIEVLTRAGS
DAVDEARAFVNRVKGEGRGTDVLFLDHAKERYLPDLKLYEDAGIVRQGTIVVADNVVYPG
APGYLEYVDSASKRYDTRLLEAMFEYDQIWKKDWVTPKDALSVSVRL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
nnnncgaagcccgcggacgtgattccgtacgtcgagcgtaaggcgcggagaggggacccg
gcgagcgtcttgcgagcgtacgacgcgttcggaaggaagtatccgacgtacaaactcggg
gcggagaagagcgcgctgtacgggaacgaggtgctggatacgattgaagatttgcggtgc
gtcgtggagataggaacgtttctggggtacagcgcgatcgcgacggcgatgcggtttaga
gacccggcggcgcggatgttgtgcgtggagtttgaagagcgacacgcggacgtcgcgaga
tgggcgatcgattacgcggggttgagtgatcgcattgaggtgctcacgcgagccgggagc
gatgctgttgacgaagcgcgggcgttcgtgaatcgagtgaaaggcgaggggcgagggacg
gatgtgttgttcctcgatcacgccaaggaacgatatttgccggatttaaagctgtacgaa
gacgccggaatcgttcgtcaaggcacgatcgtcgtcgcggataacgtcgtttatccgggc
gcgccggggtatttggagtacgtcgacagcgcgtcgaagcggtacgacacgcgactgctt
gaagcgatgtttgagtacgaccaaatttggaagaaggactgggtgacgccgaaggacgct
ttaagcgtatccgtgagactttga

DBGET integrated database retrieval system