KEGG   Ostreococcus tauri: Ot09g03530Help
Entry
Ot09g03530        CDS       T01358                                 

Definition
RA54B_CHICK DNA repair and recombination protein RAD54B (ISS)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ota  Ostreococcus tauri
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ota00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ot09g03530
Enzymes [BR:ota01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Ot09g03530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
9
AA seq 792 aa AA seqDB search
MDGNRAPARIGASRDARAPFRAPCRATATTATTATPRTTSAAGAVKRARGGGRRREAAEL
EKVRGRCGDIEWRRHRGGRGGTIVEGTTTELGAYEVEIGEEIPEADVASGVVFSRGGTAA
VAPREERVEVVSGVKLGGFVAPVRGGGATSSGAKPAAPMRTVEEPLHSDVAENALVLSTR
ETNFYRRDVRTACPVVCDPFIAKFLRPHQRDGLKFMFECVMGLRASAHTNKAHTGCLLAH
EMGLGKTLQVIALVWTLLKQSPFKRGCPTCRRVVICVPASLVGNWAAEFKKWLGPERIDP
KVVEGGDKDAQKSFEEFALSSQRRYNVLITSYETLTAKSEALARANIDLLVCDEAHRLKN
ASQTTKGAMALSSLKCHRRVLLTGTPVQNDLDELWGVMDFACPGLMGDLSSFKTIYATPI
EKAGERGAKEDVVRIGNARRDEVSKLIGPFIHSRKADEINASLLPPKTEYVVFIRLTETQ
RALYVEQLKAKSMQAMLGRIGKTDDAISPLSAIQTLQKLCNAAALASEAHRDDPIETSSK
LCVLRSMFRALPSDERIVIVSGFTTTLDLIALLCEGEKLKYDRLQGSTPPKDRTAIVRKF
NTTGRILLLSTKAGGVGLNLVGANRLVLVDSSWNPAHDLQAQARIWREGQTKKCTIYRLL
STGTIEERMFQRQELKGSLARTLGFKSTSTASNGGGSSSTFTQAELRDLFSLVKDTKCDT
ADRIAAQPGDTPKHWCDDASLTTTDVLLLNVARDELITFVAELPSAESDTTIVCEDDDDE
FSFDCPSESDGE
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaaccgagcacccgcgcgcatcggggcatcgcgcgacgcgcgcgcgccgttt
cgcgcgccgtgtcgcgcgacggcgacgacggcgacgacggcgacgcctcggacgacgtcg
gcggcgggcgcggtgaagcgagcgcggggcggcgggcggcggcgggaagcggcggagctc
gaaaaagttcgcggacggtgtggtgatatcgagtggagacggcaccgcggaggacggggt
gggacgatcgtggaggggacgacgacggagttgggggcgtacgaagtggaaatcggcgag
gagataccagaggcggacgtcgcgagcggcgtggttttctctcgaggtgggaccgcggcg
gtggcgccgagggaggaaagggtcgaggtggtgtctggggtgaagctcggtgggttcgtt
gcgcccgtgcgaggcggtggggcgacgtcgagtggagcgaaaccggcggcgccgatgcgt
accgtcgaggaaccgcttcacagcgacgtcgccgagaacgcgctcgtgctgtcgaccaga
gagacgaatttctatcgacgcgacgttcgaacggcgtgcccggtggtgtgcgatcctttc
attgcgaagtttctccgtccgcaccaacgtgacggattgaagtttatgtttgagtgcgtc
atgggcttgcgcgcgagcgcgcacacgaacaaggcgcacaccggatgtctgttagcgcac
gagatgggtttagggaaaacgttacaagtgatcgccctggtgtggactctgctcaagcaa
tcaccgttcaaacgcggatgcccgacgtgtcgccgcgtcgtgatttgcgttccagcctcg
ctcgttgggaactgggccgccgaatttaagaagtggttgggaccagagcgaatcgaccca
aaagtcgtcgagggtggtgacaaggacgcacagaagagtttcgaggagttcgcactttca
tcccagcgacgatacaacgtgctcataacttcatacgagacattgacggcgaagagcgaa
gcgctggcccgagcgaacatcgacttgctcgtgtgcgacgaggcgcatcgcctcaagaat
gcgtcgcagacgaccaaaggcgcgatggcgctctcttctctgaaatgccatcgacgcgta
cttctcacgggaacgccggttcagaacgatttggacgagttgtggggcgtcatggatttc
gcctgtcccggtttgatgggcgatctgtcgagtttcaaaaccatctacgcgacgccgatt
gagaaggctggcgagcgtggcgcgaaggaggacgtcgttcgaataggcaacgcccgccgc
gacgaggtgagtaaactcatcggcccatttattcactccaggaaagcagacgagatcaac
gcatcattgcttcctccgaagacggagtacgtcgttttcattcgtctcacggagacgcaa
cgcgcgctctacgtggaacagttgaaagccaagtcaatgcaagccatgctcggacgaatc
ggcaagacggatgacgccatttcgccgctgtcagcgattcaaacgcttcaaaagctctgt
aatgccgcggcgttggcttccgaagcgcaccgagacgaccctatcgagacgtcgagcaaa
ctttgtgtgcttcgctcgatgttccgtgctttgccgagtgacgagcgcatcgtcatcgtt
tccggattcacgacgacgctcgatctcatcgctttgttgtgtgagggtgagaagttaaag
tacgaccggttgcaaggctcgacgccgccaaaagaccgcactgcgatcgtgcgcaaattc
aacacgaccgggagaattcttttactatctaccaaggcgggtggcgtcggattaaatctc
gtcggcgccaatcgattggtcctcgtcgacagtagttggaatcctgcgcacgatttacaa
gcccaggcgcgaatttggcgcgaaggtcagacgaagaaatgtaccatttaccgattgctc
tccactggcaccatcgaggagcgcatgtttcagcgccaagaattgaagggatcgctcgcc
cggacgctcggtttcaagtcaacgagcaccgctagcaatggcggtgggtcgtcgagtacg
ttcacgcaggccgagcttcgtgacttattctcactcgtcaaggacacgaagtgcgacaca
gcggaccgcatcgccgcacaaccaggcgacacaccgaagcactggtgcgacgacgcatcc
ttgacgacgacggacgtgttactgctgaacgtcgcgcgagatgagctcattacgtttgtc
gcggagcttccgagcgccgagagtgacacgaccatcgtctgcgaagacgacgacgacgag
ttttcgtttgactgtccaagcgaaagtgacggcgagtga

DBGET integrated database retrieval system