KEGG   Ostreococcus tauri: Ot09g03720Help
Entry
Ot09g03720        CDS       T01358                                 

Definition
histone aceytl-transferase HAC108 (ISS)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ota  Ostreococcus tauri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
9
AA seq 413 aa AA seqDB search
MTKRTKTEDDAETTRRRPARVHVDVPPGVELPLEIGTKVHCAWRGKAGEKYLARVIERRR
GEGKGEEEYEYYVHYERFNRRMDSWVTLGEMDLATVEPPEKTEDGKKKEKANEPDAEHAE
FDAHALREHEEFTKVRNILQIELGRHEMDTWYFSPFPPEYNDCQKLYFCEYTLQFFKRKE
QLQRHLKKNELRHPPGDEIYRKGNLSFFEIDGKKHRLFCQNLCYLAKLFLDHKTLYYDVD
LFLFYVLMECDERGYHIVGYFSKEKCSEEGYNLACILTLPPYQRKGYGKLLISFSYELSK
IEGKVGTPERPLSDLGLVSYRGYWTRELLKILQDESKQFVSIKDLSEMTMIKTEDIISTL
QHLGLLAYTKGAYVICASPELIEKHFKAAGSGGVPCDPDAIVWSPYDPERARD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacgaacgaagacggaggacgacgcagagacgacgcggcgacgacccgcccgg
gtccacgtcgacgtcccgcccggggtggagctcccgttggagatcggcaccaaggtgcac
tgcgcgtggcggggcaaggcgggcgaaaagtacctcgcgcgcgtgatcgaacgcagacgc
ggtgaagggaaaggggaggaggaatacgaatattacgtccactacgaacggtttaatcga
cggatggactcgtgggtgacgctcggggagatggatctcgccacggtggaaccgccggag
aagacggaggacgggaagaagaaggaaaaggcgaacgaaccggacgcggagcacgccgag
ttcgacgcgcacgcgctgcgggaacacgaggagttcacaaaggtgcggaacattttacag
attgagttgggcaggcacgagatggacacgtggtacttctccccgtttcctcccgagtat
aacgactgtcaaaagctctacttttgcgagtacaccttgcagtttttcaagcgcaaggaa
cagctgcagcgacacctgaagaagaacgagctgagacacccgcccggggatgagatctac
cgcaagggcaacctgagctttttcgagatcgacggaaagaagcacaggctgttttgccag
aacctgtgctacctggccaagctgtttttagatcacaagacgctgtactacgacgtcgac
ctctttttgttttacgtcttgatggagtgcgacgaaagagggtatcacatcgtcgggtac
ttctccaaggagaaatgttcagaggagggatacaacttggcgtgcatcttgactctgccg
ccgtatcagcgcaagggatacggtaagcttctgatttccttttcgtacgagttgtccaaa
atcgagggcaaggttggcaccccggaacgtccgctcagcgacctcggtttggtgtcctat
cgcggatactggacccgagagctcttaaaaattttacaggacgagagtaaacagttcgtc
tccatcaaagacctgagcgagatgacgatgatcaagacggaggatatcatctccaccctc
caacacctcggcttgctcgcctacacaaaaggcgcgtacgtcatctgcgcgtccccggag
ctcatcgaaaaacatttcaaagccgccggatccgggggcgttccgtgtgatccagacgcc
atcgtctggtccccgtacgaccccgagcgcgcgagggattga

DBGET integrated database retrieval system