KEGG   Ostreococcus tauri: Ot09g03970Help
Entry
Ot09g03970        CDS       T01358                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ota  Ostreococcus tauri
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ot09g03970
Enzymes [BR:ota01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Ot09g03970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
9
AA seq 279 aa AA seqDB search
MSTTYRGARAIDVRGAEGSRATLTEHGAHVVRWVGPDGDERVFTSRAAVLDGARAIRGGI
PICFPQFSDLGPCATSHGFARCVRWETKETRDGRCAMTTRATSEEFKAPHETTYEVELLD
DGSMRTTLRVRNAGAEAFGFTTALHTYFRVGDAERTRVELGRRGLTYLDNLDGRRAKVDE
GDTVVFEGEVDRIYKSAPGTIRIVDEASSNGPRTFHIEKSESFPDAVVWNPWIEKARKMS
DFDDDEYREMVCVEVACVDEIVVAPGSTWVGSQTISVSK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgacgtaccgaggcgcgcgcgcgatcgacgtgcgcggcgccgagggctcgcgc
gcgacgctcaccgagcacggcgcgcacgtcgtgcgatgggttgggccggatggggacgaa
cgggtgttcacctcgcgcgccgccgtgctcgacggcgcgcgggcgatccggggagggata
ccgatatgctttccgcagtttagtgatctcgggccgtgcgcgacgtcgcacgggttcgcg
cggtgcgtgcggtgggagacgaaggagacgcgcgacgggcggtgcgcgatgacgacgcgg
gcgacgagcgaggagttcaaagcgccgcacgagacgacgtacgaggtggaactgctggat
gatggatcgatgcgaacgacgttgcgggtgcggaacgcgggtgcggaggcttttgggttc
acgacggcgctgcatacgtattttcgagtgggcgacgcggaacggacgcgggtcgagctc
ggacgacgcgggttgacgtatctcgataacctcgacggacgtcgcgccaaggtggacgag
ggcgatacggtggtgttcgagggtgaggttgataggatttataagagcgccccggggacg
attcgaatagtggacgaagcgtcttcgaacgggccgcggacgtttcacattgagaaatcc
gagtcgtttccggacgccgtcgtgtggaatccgtggatcgaaaaggcgcgtaagatgagc
gatttcgatgatgatgagtatcgcgagatggtgtgcgtagaagtcgcgtgcgtggacgaa
attgtcgtcgccccgggctcgacgtgggtcggttcgcagacgattagcgtgtcaaagtag

DBGET integrated database retrieval system