KEGG   Ostreococcus tauri: Ot09g04000Help
Entry
Ot09g04000        CDS       T01358                                 

Definition
mitogen-activated protein kinase (ISS)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Ot09g04000
Protein kinases [BR:ota01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Ot09g04000
Exosome [BR:ota04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ot09g04000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
9
AA seq 459 aa AA seqDB search
MSTTEDEDSACGSESSSAATGTTDGSESDDWDGSDADGGRRRSRRREHAGGDDDVVRAAR
TKRRKARKERERRRESGGEAKKAVTSKFAVCGTVFEVDAKYAPIKPVGKGAYGVVCSARE
VETNRKVAIKKIVNVFENVVDAKRTLREIKLLRHLRHENVIDIIDCVRPEAMDAFEDVYL
MYDLMDTDLYQIIRSSQSLTDEHCQYFLYQILRGLKYIHSADVLHRDLKPGNLLLNANCD
LKICDFGLARTALVDAEASEFMTEYVVTRWYRAPELLLSCAEYTSAIDVWSVGCIFAELL
GRKTLFPGKDYVHQLNLIMRVIGTPRDDSELDFINNEKARRYIKSLPVTARCNFRKLFPN
ASPKAVDLVDKMLVLDPARRITVEDALAHPYLESLHDEVDEPCAETPFTFNFEEDGRYLT
GTDIRELIYTELCSLSDEFEVKMQQLSLRSDTDSSTFAV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgacggaggacgaagacagcgcgtgcgggtcggagagctcgagcgcggcgacg
gggacgacggatggaagcgagagcgatgattgggacgggtcggacgcggacggcggacga
agacggagtcgacgacgggagcacgcgggtggggatgatgacgtggtgcgggcggcgaga
acgaagcggaggaaggcgcggaaggagcgggagcggcggagggagtccggaggtgaagca
aagaaggcggtgacgagtaaattcgcggtgtgcgggacggtgttcgaggtggacgcgaag
tacgcgccgataaagcccgtgggtaaaggcgcgtacggggtcgtgtgcagcgctcgggag
gtggagacaaatcggaaggttgcgattaagaagattgtgaatgtattcgagaatgtagtg
gacgcaaagaggacgctgcgggagattaagttgttgaggcacctgcggcacgaaaacgtc
atagacatcatcgattgcgtgcgaccggaagcgatggacgcgttcgaggacgtgtatctc
atgtatgatctcatggacaccgatctgtaccaaatcatccgcagcagccaatctctgacg
gatgagcactgccaatattttttgtatcaaattttacgcggactgaagtacattcacagc
gccgacgtcttgcacagagacttgaagcctggaaatttattgctcaacgcgaactgcgat
ctgaagatttgtgatttcggcctcgctcgcaccgcactcgtggatgcggaggcgtctgag
tttatgactgagtacgtcgtcacgagatggtatcgagcgccagagctcttgctctcgtgc
gccgagtacacgagcgctatcgacgtctggagcgtgggttgtatctttgccgagctactc
ggtcgtaagactctgttcccggggaaggattacgtgcaccagctgaatcttatcatgcgc
gtcatcggaacgccgcgagacgattcagagctcgatttcatcaacaacgaaaaggcgcgg
cgttacatcaaatcgcttccggtcacggcaagatgtaactttcggaagctcttcccgaac
gcgtcgccaaaagcggtggatctcgtggacaagatgctcgtactcgatcccgctcgtcgg
atcaccgtggaggacgctttggcgcatccgtacctggagtcgttacacgacgaagtcgac
gagccgtgcgccgagacgccgttcacgttcaatttcgaggaagacggtcgatacctcacc
ggtacggacattcgtgagctgatttataccgagctttgctccctctcagatgaatttgag
gtgaagatgcagcaactgtctcttcgcagtgatactgattcatcgacgtttgccgtgtag

DBGET integrated database retrieval system