KEGG   Ostreococcus tauri: Ot10g02260Help
Entry
Ot10g02260        CDS       T01358                                 

Definition
Translation initiation factor eIF3, p35 subunit (ISS)
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ota  Ostreococcus tauri
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ota00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Ot10g02260
Translation factors [BR:ota03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Ot10g02260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
10
AA seq 236 aa AA seqDB search
MSDDDGGWDDDDFEVPDVTKLTLARDAPVRDKFADEDAETAEERAGREHREREIAALRAK
TTAAKKVKEIKSAVSYEDDDDALSDPAAEKARRQRLVEEADLRAARELFGGGDVELETFE
PKGKGDFEKLGSAVAHKYLSRHEGGAHYVHAIKALLRVATRELTAADVKEVEVAVVAART
DKVKKEKAEAEAAKKAAANSKKGKFLNAGGGKTGAGGGLDDFKYAVDSVDDEYDFM
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgacggtggatgggacgacgacgacttcgaggtcccggacgtcaccaaa
ctcaccctcgcccgagacgcccccgtgcgcgataagttcgcggacgaagacgcggagacg
gcggaggaacgcgcggggcgagaacatcgcgagcgcgagatcgcggcgcttcgagcgaag
acgacggcggcgaaaaaggtgaaggagattaagagcgcggtgtcgtacgaggatgatgat
gacgcgctgagtgatcccgcggcggagaaggcgcgacggcagcggctggtggaggaggcg
gatctgcgcgcggcgcgcgagctcttcggcggcggagacgtggagctggagacgttcgag
ccgaaggggaagggtgactttgaaaagctcgggagcgcggtggcgcacaagtatttgtcg
aggcatgaggggggggcgcactacgtgcacgcgattaaggcgttgttgcgagtggcgacg
cgcgagctcacggcggcggacgtgaaggaggtggaggtcgccgtcgtcgcggcgcgcacg
gataaggtgaagaaggagaaggcggaggccgaggcggcgaagaaggcggcggcgaactct
aagaagggtaagttcttgaacgccggcggtggtaagacgggcgcgggtggagggttggat
gacttcaagtacgcggtggactccgtggacgacgagtacgacttcatgtga

DBGET integrated database retrieval system