KEGG   Ostreococcus tauri: Ot10g02600Help
Entry
Ot10g02600        CDS       T01358                                 

Definition
Gamma-glutamyl phosphate reductase (ISS)
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
ota  Ostreococcus tauri
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ota01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ota00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
10
AA seq 448 aa AA seqDB search
MSRRVDIRRAVPPRRVPLHNPPLMSTTDTVALARAARDASRKLQQLSSERRAALLRAVAN
ALERREDEIQRANDEDMARAAANKDVEDALLQRLKLKPGKVKQLADGARAIAAMEEPVGR
PLKSTELARGLTMTKVTAPLGVLLIIFESRPDALPQIASLALRTGNGLLLKGGKEAASSN
AKLREVIVDEFEAFGVPKECVCLIEGREAVADLLALDDVIDLVIPRGSNQLVSYVQNNTK
IPVLGHADGVCHVYVDKDADLDMAAKLAIDSKIDYPAACNALETLLIHDSLVANGGAAEL
MTALRASGVELFGGPRGTKELKLPPAPALRHEYGTLQCSVELVGSMDDAIDYIHANGSGH
TDCIITSNQKTADEFINRVDSACVFHNASTRFSDGFRFGLGAEVGISTSRIHARGPVGVE
GSICQQGQGRHVHAQGASTAQGRGRTEA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgacgcgtcgacatccgtcgagccgtcccgccgcgccgcgtcccgcttcacaac
ccacccctcatgtctaccaccgacaccgtcgccctcgcccgcgccgcgcgcgacgcgagc
cgtaagcttcaacaactctccagtgagcgtcgcgcggcgctcttgcgcgccgtcgcgaac
gcgctggagcgtcgcgaggatgagatccaacgcgcgaacgacgaagacatggcgcgcgcg
gcggcgaacaaagacgtcgaagacgcgctgttacagcggctgaaactcaagccggggaag
gtgaaacagctcgccgatggcgcgcgggcgatcgcggcgatggaagagccggtgggacga
ccgttgaagagcacggaactcgcgagaggattgacgatgacaaaggtgacggcgccgctg
ggcgtgttgttgatcatctttgaatcgagaccggatgcgctgccgcagatcgcgtcgttg
gcgttgagaacggggaatgggttattgctcaagggagggaaggaggcggcgagctcgaac
gcgaagctgcgcgaggtcatcgtggatgagtttgaggcgttcggcgtgccgaaggagtgc
gtgtgcctgatcgagggtagagaggcggtggcggatctcttagcgctcgacgacgtgatc
gatctggtgatcccgcgtgggtccaatcagttggtgtcgtacgtgcagaacaacacgaag
attcccgtgctcgggcacgccgacggcgtgtgtcacgtgtacgtggacaaggacgccgac
ttggacatggcggccaagttagcgatcgattccaagattgattaccccgcggcgtgcaat
gcgctggagacgttgctcatccacgacagtttagtcgcgaacggcggcgcggcggagctc
atgacggcgcttcgagcgtccggggttgagctcttcggaggtccgcgaggcacgaaggaa
ctcaagctccctccggcgccggcgcttcgtcacgagtacggcaccttgcagtgctccgtg
gagctcgtggggtcgatggacgacgccatcgactacatccacgccaacggctctggacac
accgactgcatcatcacctcgaaccagaagacagctgacgagttcatcaaccgcgtcgat
agcgcgtgcgtcttccataacgcctcgacgcgtttcagtgacggattcaggttcggactc
ggcgccgaagtcggcatctcgacctcgcgaattcacgcgcgcggaccggtgggtgtcgag
gggtcaatttgtcaacaaggacaagggcgtcacgtacacgcacaaggcgcttccactgcc
caagggcgcgggcggaccgaagcctaa

DBGET integrated database retrieval system