KEGG   Ostreococcus tauri: Ot10g03620Help
Entry
Ot10g03620        CDS       T01358                                 

Definition
U4/U6-associated splicing factor PRP4 (ISS)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Ot10g03620
Protein kinases [BR:ota01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   Ot10g03620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
10
AA seq 772 aa AA seqDB search
MSSDASSIGRVLSIPSTPRSNNGRDNANDDLILREGEELGERVGSASPTSGSTKAVRNGG
KGVVHPRDDEDVSESSSSGATYTVVDTLGSGTFGQVVSVSSSVDGSTLALKVIKNHPAYF
HQAHVEIGILRTLNMTCGDRPAGSVIVELADYFICHNHLCLVFELLGMNLYELLRKNKFK
GLHLGAIRGIMKQLLSALDVLRDAHVVHCDIKPENILLVRDNSFQVKLVDFGSACFQNRT
VYQYIQSRFYRSPEVFLGMPYGMPIDMWSLGCVAAELFLGLPIFPGSSEYDLLCRICETM
GTPPTEMLAKAPNTNKFFTRVDIGFGESSSSLASSSESGTSKYKLLSLRDFEARTGRRAA
MGKKYFKYTELADIIASIPYQSSKVDPNDAGAIAAEKKARVNERSAFYDLLVGMMEIDPA
TRWTPAQALKHPFVTGDAFEGPFTPPKILERTTPEEREEIQRLAAKEAAKVSSGEPLKKK
KKPQPVEPPEGIVPPTPPAVQPTLLRRSTTPCCKRKLRRTRTRRRRSPPSACPRAECPCP
RAVASAEDTRRSSSFIGSPHAMNSAAMHPLHFGMSPPTQQLSNMGLSTSHQVRAAQAAAA
VHLPSASPLGKRGTTLARGMAPNAQAMPATSYSGAPSGFGWSPLASASASRENLKTLQPV
PESQSPPMASPSPDGEVTEEDRAEGADWDPTFDDALDDEATDENNSEERADDEANPVPAR
AFPVKAKQILPPQFAVGSAPTFVASGFGVSPNSAFGNNKTVRKRNAGKDAAT
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgacgcgagctcgattggacgcgttctgagtataccgtccacgcctcggtcg
aacaacggacgagataacgcgaacgacgacttgatcctgcgagaaggggaggagttgggc
gagcgcgttggatccgcgtcgccgacgagcgggtccaccaaagcggtgcgaaatggagga
aagggcgtcgtgcaccccagagacgatgaagacgtgtcagagagctcgagtagtggggcg
acgtacacggttgttgacacgctcgggtcgggaacgttcggacaagtcgtgagtgtttcg
tccagtgtagacgggagcactcttgcgctcaaggtgattaagaatcatccggcgtacttt
caccaggcgcacgtggagattggaattttgcgaacgcttaacatgacgtgtggcgatcga
ccggcggggtcggtgatcgtagagctcgcagattacttcatctgccacaaccacttgtgc
ctggtgtttgaacttctcggcatgaacctgtacgagctgctgcgaaagaacaaatttaag
ggtttgcatctcggcgcgattcgaggaattatgaagcagttattgtcggcgttagatgtt
ctccgggatgcccacgtcgtacattgcgacatcaagccagagaacattttgcttgtccga
gacaactcatttcaagtcaaactcgtcgactttgggagcgcgtgctttcaaaacagaacc
gtgtaccaatatatacagagtcggttctaccgctcaccggaggtcttcttggggatgcca
tacggcatgcccatcgatatgtggtcgctcggctgcgtcgccgccgagctattcctcggt
ttacccatatttccgggatcgagcgagtacgacttgctgtgtcgaatttgcgaaaccatg
ggtacgccacccaccgaaatgttagccaaggcaccgaacacgaacaaattctttaccaga
gtcgacatcggattcggagaaagctcttcgtcgttggcgtcgtcgagtgaaagcgggacg
tcaaagtacaagcttctttcgctgcgtgatttcgaagcgcgcacgggacggcgggcagcc
atggggaagaagtacttcaaatacaccgagttggcggatatcatagccagtataccgtat
cagtcatcaaaggtcgatccaaacgatgcgggtgcgatagcggcggagaagaaggcacgg
gtcaacgagcgctcggcgttttacgatttgctcgtgggaatgatggagatcgatccggca
actcgctggacgccagcgcaagccttgaagcatccattcgtcacgggcgacgccttcgag
ggaccgtttacgccgccgaagattctggagcgaacgacaccggaagagcgcgaagagata
cagcgcctcgccgcgaaagaggcggccaaagtttcctctggagagcctctcaagaagaag
aagaagccgcaacccgtcgaaccgccggaagggatcgtaccgccgacaccgccggccgtg
caaccgacgctcctcaggcgttcaacaacgccatgctgcaagcgcaagctgcggcgcacg
cgcacgcggcggcgacgctcgccgccatcggcatgtccccgggcggagtgcccatgtccc
cgggcggtggcgtcggcggaggatacccgccgttcgtcctcgttcatcggttctcctcac
gctatgaatagcgcggccatgcatccactacactttggtatgtcgccgcctacgcaacag
ctgtcgaatatggggttgtcgacgtcgcatcaagtgcgcgctgcgcaagcggcggctgcg
gtgcaccttccttccgcaagtccgcttggtaagcgaggaacgacgctcgctcgtggtatg
gcgccgaacgcgcaggctatgccggcaacttcgtactcgggcgctccctctggcttcgga
tggagtccattggcgtcagcttcagcttcgcgcgagaacttgaagacattgcagcctgtg
cctgagtcgcagtcgccacccatggcttccccgagtccggatggcgaagttaccgaggaa
gatagagccgaaggagcggattgggaccccacgtttgacgacgcgctcgacgacgaagcg
acggacgaaaacaattctgaggagcgtgccgacgatgaagcgaatcccgttcccgcgaga
gcttttcccgtcaaggcgaaacaaatccttcctccacagttcgcggtagggtcagcacct
acgtttgtcgcgagcgggtttggagtatctccaaactctgctttcggcaacaacaagacg
gttcgcaagcgaaacgctggaaaagacgccgcgacgtga

DBGET integrated database retrieval system