KEGG   Ostreococcus tauri: Ot11g00020Help
Entry
Ot11g00020        CDS       T01358                                 

Definition
putative ubiquitin-specific protease (ISS)
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Ot11g00020
Peptidases [BR:ota01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Ot11g00020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
11
AA seq 688 aa AA seqDB search
MARGGRTARAAAESDTAGRFARGRALETTSAVRLGEDVAVDRVVRFVRARRPDRPLIDAD
SLRDVVVLNGGALVEETTTSNKGTDAEDEMPRGMSTRGMDRGDDLYATRDVRMSWFGARR
AGAGLANLGNTCFLNSVLQCLTHTPALAHFALSGEHKKYKTSGSFNAMYEIGEHVARALN
SSGRTIAPTAVVKNMRALSKTFRKGRQEDAHELARCLLDAMHKKCVELVKPKISPNSARG
ETSFVWKVFGGKLRSRVNCKTCGRNSETFDPFLDLSLEVGRAKSVLGAFKLFTHTEILDG
DNKYKCEGKNPGQSKPHFTKASKQFTVDQAPNVLAVQLKRFAYVPFGRGKLSHFVEYPLV
LDVTPYLSDEDRNSKNRAVYDLYGVLVHAGSSSNSGHYYCFVKTATGTWCEMDDESVSSV
SEKTVLKQQAYLLFYARRNAPGTFEQMKKLCQNVPDAARALNSLETKSAAAELKTQPAEK
RKQETVENVRAKKETVSKENVSTPSLGKRKLGDLNGRASPVRSSVGRSIVRSKSPSVRSA
FDSAKRALLLRRLRRLSHDVGVTLEDIPAVIASDAPVRTRNAMKEDDGEALRDWLAKTST
SAKWDEEDGDAQQTKKKKKTPPHEPQTKMSASGTRARRAYDQFDEEYDRGKTPKHRRRKE
KAASAPPLPKPGAHRARQRNPFQKRGAV
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggggtgggcgaacggcgcgcgcagccgccgagagtgataccgcgggaagattc
gcgcgcggacgggcgttagagacgacgagcgcggtgcgactcggtgaagacgtcgcggtc
gatcgcgtcgtacgattcgtgcgagcgagaagaccggatcgaccgctcatcgacgccgat
tctttgcgggacgtcgtggtgttgaacggaggagcgctcgtcgaagagacgacgacgtca
aacaaagggaccgacgccgaagacgagatgcctcgagggatgagcacgagagggatggat
cgaggggatgatttatacgccactcgggacgttcgcatgtcgtggtttggtgctcgtagg
gcgggtgccgggttagcaaatttggggaatacctgctttctgaattcggtgcttcagtgc
ttgacgcacacgccggcgttggcacattttgccctcagtggagagcacaagaagtataaa
acgagcggctcgttcaacgccatgtacgagatcggtgagcacgtcgctcgagcgttgaat
tcgagcgggagaactatcgctcctaccgcagtggttaagaacatgcgggctctttcaaag
acatttcgcaagggccggcaggaggacgcgcacgagttggcgcgttgcctccttgatgcg
atgcacaaaaagtgcgtggagttggtcaagcctaagatttcgccgaacagcgctcgagga
gagacaagctttgtgtggaaagtgtttggcggaaagcttcgttcgcgcgtgaactgcaag
acgtgcgggcgcaatagcgaaacgttcgacccgtttctcgatctttcgttggaagtagga
cgcgcgaagagcgtgctcggggcgttcaagttattcacacacactgagatactcgatggt
gataacaaatacaagtgtgaagggaagaacccgggtcaatccaagccgcatttcacgaag
gcgtcgaagcagttcacggtggaccaagcgccaaacgtactcgcggtgcagctcaagagg
ttcgcctacgtgccgttcggtaggggtaaactcagtcactttgttgaatatcctctggtg
ttggacgtgacgccctatctctctgacgaagaccgcaattcaaagaatcgcgcagtgtac
gatttgtacggcgtgcttgtgcacgccggaagcagctcgaacagtggacattattattgc
tttgtgaagactgcgactgggacgtggtgcgagatggacgacgagagtgtcagctcagtg
agtgagaagacggtactcaagcagcaggcttatttattgttttacgcgcgcagaaacgcg
ccgggtacatttgaacaaatgaaaaaactgtgtcaaaatgtaccagacgcggcgagagcg
ctgaatagtttggagacaaagagcgctgcggcagagctgaaaacgcagcctgctgagaag
cgtaaacaagaaacagtggagaatgttcgcgcgaagaaagagacggtatcgaaggaaaac
gtttcgacgccgtcactgggaaagagaaagcttggagatttgaacggccgggcgtcgccc
gtgcgctcgtcagtcggcagaagtattgttcggagcaaatcgccatcagtgcgaagcgct
ttcgattctgcaaagagagcgcttttacttcgtcgattgagacgtctgagtcacgacgtt
ggagtcactttagaggatattccggcagtaatcgcctcggacgcgccagtaagaacacga
aatgcgatgaaggaggacgatggcgaagctttgcgcgattggttagcgaagacgtcgacg
tctgcgaaatgggacgaagaagacggagatgcgcagcaaactaagaagaagaagaaaacg
ccgccgcatgagccgcaaacgaaaatgtctgcgagcggaacgcgcgcgcgtcgtgcgtac
gaccagttcgacgaggagtatgatagagggaaaactccaaagcatcgaagacggaaagaa
aaagcagcgagcgcgccgcctcttccgaaaccgggagcgcatcgcgcgcgacagagaaac
ccatttcaaaaacgtggtgctgtgtag

DBGET integrated database retrieval system