KEGG   Ostreococcus tauri: Ot11g02290Help
Entry
Ot11g02290        CDS       T01358                                 

Definition
4-alpha-glucanotransferase; disproportionating enzyme (ISS)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ota  Ostreococcus tauri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ot11g02290
Enzymes [BR:ota01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Ot11g02290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
11
AA seq 336 aa AA seqDB search
MSNPVDGALHTVERARKLFFGDHVQDVAYRYMVEKDDQRGLWQFRPDFQTEESIIAATKP
HKNTPANLIGDQLAIRDGLMKLFQNRCLLTDKENYDNFYPRFGLEDTSSYQALEGWQRET
LRELANDYYFGRQMDTWRNQARMVLPALLRSSDMLVCGEDLGFTPTCVPPVMDELGILGL
RIQRMPPVGESAEFGQPHTYSYLTVCSPSCHDTMTTRAWWEQDEARRQRYDAMFHGGTDE
KCTPNVMRNILVQHIESPSVLAIFPIQDLLALDAEYAKRPALEETINDPTNPKHYWRYRL
HVPCEDMLANGAFVKEIRELLRARAHVNQSSHLRLN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacccggttgacggagccttacatacagtggaacgagctcgaaaactctttttc
ggcgatcacgtccaagacgtggcttaccgttacatggttgagaaagacgaccaacgtggt
ttgtggcagttcagacctgactttcagactgaggagtcgatcatcgccgccacgaaacct
cataagaacacgccagcaaacttaatcggagatcaactcgcgatacgcgatggtctcatg
aaattgttccaaaataggtgtcttctgacggacaaagaaaattatgacaacttctatcct
cgattcggtctggaagacacgagttcttatcaagcgctcgagggatggcagcgcgagacg
cttcgcgagttggcgaatgattattacttcggtcgtcagatggatacgtggcgaaatcag
gcgcgcatggtgctaccggcgctattgcgctcgtcggacatgctcgtgtgcggtgaagat
ctcggtttcacgccgacgtgcgttccgccagtgatggacgaacttggcattttgggcttg
cgcatccagcgcatgccacccgtcggcgagagcgcggagttcggtcaaccgcacacgtat
tcctatttaaccgtctgctcgccttcttgtcatgatactatgaccacgcgcgcgtggtgg
gaacaagatgaggcgcgcagacagcgttacgacgccatgtttcatggtgggaccgatgaa
aaatgtacgccgaatgtcatgcgcaacattctcgtgcaacacatcgagagtccgagtgtt
ttggccatctttccgatccaagatctgctcgcactcgacgcagagtacgcgaagagacca
gctcttgaagagacgatcaacgacccgacgaatccgaagcattactggagatacagactc
cacgtgccgtgcgaggacatgttggccaacggtgccttcgtgaaagagatcagggaactc
cttcgagctcgagcacacgttaatcagtcaagtcacttgcggcttaactaa

DBGET integrated database retrieval system