KEGG   Ostreococcus tauri: Ot11g02300Help
Entry
Ot11g02300        CDS       T01358                                 

Definition
putative 4-alpha-glucanotransferase (ISS)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ota  Ostreococcus tauri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ot11g02300
Enzymes [BR:ota01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Ot11g02300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
11
AA seq 456 aa AA seqDB search
MVRVAFETTYWTNWGDHVRVVGACAALGRWDARAAPAMTCAHGANARELIWTAVVDLDVD
GDDDDDGIAYRYVVVDARGAVAAFDGEMKMLDLKRGRRGTTRAETRDAWGGRTPWEAVLA
RAAFANVVGTSAGTMCARDGGVEGDGVVREGGADGPRVRLEIRAPRERGERRVMVRGTCA
ALGKGDRSRAKAMSKAAGSDVWWIEFDVDASETPFEYAYFVSDDAGADVEDVRGALVCSP
SASEEEMKSTMVIHRDGALSVGEMWKGAGVALPVFSVRTSKSVGCGDFVDLRRVVDFASE
TGMSVVQVLPVNDTCVYGTFWDSYPYSSLSVHALHVMYLRAQDLPGVNEELAEDIETARA
ALDLEEIDYEMTVKEKLSFARRAYYNSGEKVFETDGFKEFYARNEHWLRPYGVFCVLRDL
FGTAEHWRWGVFAKYSEDVLDKVDCEGGDLYESTXX
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcgtggcgttcgagacgacgtactggacgaattggggcgaccacgtgcgcgtg
gtcggcgcgtgcgcggcgctcgggcggtgggacgcgcgcgcggcgccggcgatgacgtgc
gcgcacggcgcgaatgcgcgtgaattaatctggacagccgtggtcgatctcgacgtcgac
ggcgacgacgacgacgatgggatcgcgtacaggtacgtcgtcgtcgacgccaggggcgcg
gtcgcggcgttcgacggagagatgaagatgctggatctgaaaaggggacggcgcgggacg
acgcgggcggagacgcgagacgcgtggggggggcgaacgccgtgggaggcggtgttggcg
cgcgcggcgttcgcgaacgtcgtggggacgagtgcggggacgatgtgtgcgcgcgatggg
ggggtggagggcgatggagtggtgcgcgagggcggcgcggatggaccgcgcgtgcggttg
gagattcgcgcgccgcgcgaacgaggcgagcgtcgagtgatggtgcgcggcacgtgcgcg
gcgttggggaagggggatcgctcgcgagcgaaggcgatgagtaaggcggcgggaagcgac
gtgtggtggatcgagtttgacgtcgacgcgtcggagacgccgtttgagtacgcgtatttc
gtgagcgacgacgcgggcgcggacgtcgaggacgttcgcggcgcgctcgtgtgttcgccg
agcgcgagcgaggaggaaatgaagagtacgatggtgattcatcgcgacggcgcgctctct
gttggagagatgtggaagggtgcgggtgtggcccttcccgtgttctccgttcgcacgtcg
aagagcgtcggttgcggcgactttgtggatttgcgccgcgtggtcgacttcgcgtccgag
accggcatgtccgtcgtccaggtgttaccggtgaacgatacgtgcgtgtacggcacgttc
tgggactcgtatccgtactcgtctctctcggtgcacgcgttacacgtcatgtatctgcgc
gcgcaagatttgcccggagtgaacgaggaactggcggaggatatcgagaccgcgcgcgcg
gcgttggacctggaagagatcgattacgaaatgactgtgaaagagaaactctctttcgcg
cgtcgggcgtattacaacagcggcgagaaagtcttcgagacggatggatttaaggagttt
tacgcgaggaacgagcactggctcagaccgtacggcgtcttctgcgtgttgagggacttg
ttcggcaccgccgagcactggcgatggggagtgttcgcgaagtattcggaagacgtcttg
gacaaggtcgactgcgagggaggcgacctgtacgagtccacgcnnnnn

  All links  
No link information was found.   
DBGET integrated database retrieval system