KEGG   Ostreococcus tauri: Ot12g01070Help
Entry
Ot12g01070        CDS       T01358                                 

Definition
histone H2B (ISS)
Orthology
K11252  
histone H2B
Organism
ota  Ostreococcus tauri
Brite
Exosome [BR:ota04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ot12g01070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
12
AA seq 138 aa AA seqDB search
MTRREPARELTGNDEVARACTPIRHNLTRKPAQKKPSGAKKGGRKSKTETYKIYIYKVLK
QVHPDTGISSKAMSIMNSFINDIFEKIATEAAKLARYNKKPTVTSREIQTAVRLILPGEL
AKHAVSEGTKAVTKFTSA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgactcgaagagagcccgctcgtgaactcaccggaaacgacgaagttgcgcgcgcctgc
acgccgattcgtcacaacttgacacgcaagcccgctcaaaagaagccgtccggcgccaag
aagggtggccgcaagtccaagacggagacctacaagatctacatctacaaggtcctcaag
caagtgcacccagacaccggcatctcctccaaggccatgtccatcatgaactcgttcatc
aacgacatcttcgagaagatcgcgaccgaggccgccaagctcgcgcgatacaacaagaag
ccgacggtgacgtcccgcgagatccaaacggccgtccgactcatcctcccgggtgagctc
gcgaagcacgccgtgtccgaagggaccaaggcggtgaccaagttcacctccgcgtaa

DBGET integrated database retrieval system