KEGG   Ostreococcus tauri: Ot12g01990Help
Entry
Ot12g01990        CDS       T01358                                 

Gene name
KGUA
Definition
Guanylate kinase (IC)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ota  Ostreococcus tauri
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ot12g01990 (KGUA)
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Ot12g01990 (KGUA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
12
AA seq 225 aa AA seqDB search
MPPRPLVVVGPSGVGKGTLIAMLQREFPDKFGFSVSHTTRAPRPGEVNGTHYNFVDKATM
ERDIASGKFLEHANVHQNIYGTSFAAVRAVSKQGRICILDIDVQGAEAVKKSTLNAAYVF
IAPPSMEELEKRLRGRGTEAEDAVLKRLENARTEMAKKDVPGFFDAIIVNDDLDAAYEAL
KRVIAERVESDSNSRIDLARLGPYAFGVACAVAIAARVIINKGGP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcgaccgctcgtcgtggtcggaccgtccggggtggggaaagggacgttgatc
gcgatgcttcagagagagtttcctgataagtttgggttctctgtgtcgcacaccacgcgg
gcgccgcgtccgggggaggtgaacgggacgcactacaactttgtggacaaggcgacgatg
gagcgggacatcgcgagcgggaagtttttggagcacgccaacgtgcatcaaaacatctac
ggtacgtccttcgcggccgttcgcgcggtgtccaagcagggaaggatttgtatcctcgat
atagacgtgcagggcgcggaagcggtgaagaagtcaacgctgaacgcggcgtacgtgttc
atcgcgccgccgtctatggaggagctcgaaaagcgactgcgcggacgcggcaccgaggcc
gaggacgccgtgttgaagcggctcgagaacgctcgaacggaaatggcgaagaaggacgtc
cccggtttcttcgacgcgatcatcgtgaacgacgatctagacgccgcgtacgaggcgttg
aagcgcgtcatcgctgagcgcgtcgagtccgattccaactctcgaatcgacctagcgagg
ctcggtccgtacgccttcggcgtcgcgtgcgccgtcgccatagccgcccgagtcatcatc
aacaagggcggtccg

DBGET integrated database retrieval system