KEGG   Ostreococcus tauri: Ot13g00010Help
Entry
Ot13g00010        CDS       T01358                                 

Definition
Ubiquitin C-terminal hydrolase (ISS)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Ot13g00010
Peptidases [BR:ota01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Ot13g00010
Transcription machinery [BR:ota03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Ot13g00010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
13
AA seq 386 aa AA seqDB search
MPRCASADERATTEGRCEKNTSTAMASSSPRCLPRGLRGSVNMGNTCFVASVLQALVATP
SVVEFFLGERHARSECAVEHCAACALDAYVCEAYGEKDSTSRALVASEVLHAWWQNERSM
AKQQQQDAHEFFLSFLSVAHANVLGKSLRREKKRPVGLEALLSLDITGLDEDEDEEADAA
GVDAKVNVSVDACDCVFHRSFAGLLRSDVACAACGEMTSTILEATVGISIDVPSGTASSE
LTDCLRAFTAAESIESRGCATRGCATTRLTKRVLFERLPRTLTFHLKRFEGGFESNSVRK
NDVHVRFPLDIDMSPFVVDGSMQAKNVYKLYAVVVHSGILEGGHYTVYIRRAWTWFLCDD
ANVREVDASHVFAAQAYMLFYQISQS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcctcggtgcgcgtccgcagacgagcgcgcgacgacagaggggcgatgtgaaaaaaac
acatcgaccgcgatggcgtcctcctcgccgcggtgtcttcccagagggctcagaggctcg
gtgaacatggggaacacgtgcttcgtcgcgagcgtgctccaggcgctcgtggcgacgccg
tccgtggtggagttctttctcggtgagagacacgcgcggagcgagtgcgcggttgagcac
tgcgcggcgtgcgcgctggacgcgtacgtgtgcgaggcgtacggggagaaagattcaacg
tcacgcgcgctcgtggcgagcgaggtgcttcacgcgtggtggcaaaacgaacggtccatg
gcgaagcaacaacagcaggatgcgcacgagtttttcctgagctttctctccgtcgcgcac
gcgaacgtactcggcaagagtctacgacgggaaaagaaacgtccagtcggactggaggcg
ctcttatcgctcgatatcactggtctggacgaggatgaggatgaagaagctgatgcggcg
ggcgtggacgcaaaggtcaacgtgtctgtcgacgcgtgtgactgcgtctttcatcgttca
ttcgccggtctgcttcgatcagatgtcgcgtgcgcggcgtgcggggaaatgacgtcgacg
attttagaagcgacggtgggaatatcaatcgacgtgccgtccggaacggcgtcgagcgag
ctcactgattgtctcagagctttcaccgccgctgagtcgattgagagccgcggctgtgca
acccgcggctgcgcgacgacgaggctgacgaaacgcgttctgttcgagcgtttgccgcga
acgcttactttccatttgaaacggttcgaaggaggtttcgaatcgaattcagttcgcaag
aatgacgttcacgtaaggtttccgctcgacatcgacatgtcgccgtttgtcgtcgatgga
tcgatgcaagcaaagaacgtgtacaagctctacgccgtggtcgtgcacagcggaatactc
gaaggtggccattatacggtgtacatccgtagggcttggacgtggtttctgtgcgacgac
gcaaacgtgcgagaggtggacgcttcgcacgtgttcgccgcgcaagcgtacatgctcttc
taccaaatttcgcaatcgtag

DBGET integrated database retrieval system