KEGG   Ostreococcus tauri: Ot13g01160Help
Entry
Ot13g01160        CDS       T01358                                 

Definition
Single-stranded DNA-binding replication protein A (RPA), medium (30 kD) subunit (ISS)
Orthology
K10739  
replication factor A2
Organism
ota  Ostreococcus tauri
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ota00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Ot13g01160
   03420 Nucleotide excision repair
    Ot13g01160
   03430 Mismatch repair
    Ot13g01160
   03440 Homologous recombination
    Ot13g01160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
13
AA seq 262 aa AA seqDB search
MYGGESATQFAGATGYMGEPDASGMKPRASGGNQPNTMTPVTVKMIKGALDARASPDDEI
KVNGMAIMNITLVGKVVDVQTKGSQVVYRLDDSTGQTDVKVWLDSDGPVEEIPRGAYVRV
YGTPKAVGADQVIAAHTTESIRVITDFNEITYHLLEVIYASGYAAKVKSGGGATGVAPQS
VYSAVQAAPNVAADGDMNGSLCDRVLFIVKNNPNGDTGISVLEVVEKLGGQFTDAAVRQE
LESLSNDGAVYTTVDEDHYQAV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcggtgaatcggcgacgcagttcgcgggagcgacgggatacatgggagagccc
gatgcgagcgggatgaagccgcgcgcgagcggcgggaaccagccgaacacgatgacgccg
gtgacggtgaagatgattaaaggggcgttggacgcgcgcgcgagcccagacgatgagatc
aaagtgaacgggatggcgatcatgaacatcacgctcgtgggcaaggtggtcgacgtccaa
acgaaggggtcacaggtggtgtacaggttggacgacagcacgggccaaacggacgtcaag
gtgtggttagactctgacgggccggtcgaagagattccgagaggtgcgtacgttcgagtc
tacggaacgccgaaggcagtcggggccgatcaagtgattgccgcgcacacgacggaatcg
atccgcgtgataacggatttcaacgagatcacgtaccacctcctcgaggtcatctacgcg
agcggctacgccgccaaggtcaagtccgggggcggcgccaccggtgtggcgccacaaagt
gtgtacagcgccgtgcaagcggcgccgaacgttgcggctgatggtgacatgaacggttcg
ctctgcgatcgcgttctcttcatcgtcaagaataaccccaacggcgacaccggcatctct
gtgttggaggtcgttgagaagttgggcggtcagttcactgatgccgccgttcgtcaggag
ctcgagagtttgtcgaacgatggtgccgtgtacaccaccgtggacgaagaccactaccaa
gccgtctaa

DBGET integrated database retrieval system