KEGG   Ostreococcus tauri: Ot14g00440Help
Entry
Ot14g00440        CDS       T01358                                 

Definition
P0528B09.47-1 gene product (ISS)
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ota  Ostreococcus tauri
Brite
Protein phosphatases and associated proteins [BR:ota01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Ot14g00440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
14
AA seq 191 aa AA seqDB search
MGLTASSLNLTQYDIEDVQQHCDGKFTSREIQALYARFRSLDKRHKGFLTEDELMAIPEL
AISPLAPRIVQMFQNQNFKDFVKMLSALSPRASRDDRLRFMFQCHDVDRDGEIARSDLET
MTRHLVGSSVSEEDFNALIHRAFEDLRAMRAERADAREGSARGVAFDEFRRALSAVDRTL
PTVRVPVDDDA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaccgcctcctccctcaacctcacccagtacgacatcgaggacgtccagcaa
cactgcgacgggaagttcacgtcgagagagatccaggccctgtacgcgcgattccgatcg
ttggacaagagacacaaaggattcctcaccgaggatgaattaatggccatccccgagctc
gccatctccccgctcgcgccgagaatcgtgcagatgtttcaaaatcaaaactttaaggat
ttcgtgaaaatgttaagcgcgctctcaccgagagcgagtcgggacgatcgcttgcgcttc
atgtttcagtgccacgacgtcgaccgggacggcgaaatcgcgcgaagcgatttagaaacc
atgactcgacatctcgtgggatcgagcgtgtccgaggaagacttcaacgcgttaatacac
cgagcgtttgaggatttacgggcgatgcgcgccgagcgcgcggacgcgcgcgaggggtcc
gcgcgcggcgtcgcctttgacgagttccgacgcgccctctccgcggtcgatcgcacctta
cccaccgtgcgcgtccccgtggacgacgacgcgtga

DBGET integrated database retrieval system