KEGG   Ostreococcus tauri: Ot14g02170Help
Entry
Ot14g02170        CDS       T01358                                 

Definition
putative pyrophosphate-fructose-6-phosphate 1-p (ISS)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ota  Ostreococcus tauri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ot14g02170
   01230 Biosynthesis of amino acids
    Ot14g02170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ot14g02170
   00030 Pentose phosphate pathway
    Ot14g02170
   00051 Fructose and mannose metabolism
    Ot14g02170
   00052 Galactose metabolism
    Ot14g02170
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ot14g02170
Protein phosphatases and associated proteins [BR:ota01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ot14g02170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
14
AA seq 505 aa AA seqDB search
MDFEFGRALNKTTTTTARASAESAIDARLEGDDDESEDDAFYSWRVGGANDLKITHLRDV
YRGDVPLVAQPSPFCTTTACPLSGPRTSVEFNSNFVSNSDRVLLNSVAFGSSADPTQTCS
LWAETFDPNGCDYVPQWVVRAGPRSEVYFDSDEVHAAIVTCGGLCPGINDVIRSLVNTLE
VGYGVKKISGIRYGFKGFFSGVEFMKLNKKTVRNIHTLGGSMLGSGRGGGDVQKIVESII
HHGINMVFVIGGNGTHAGANAISDECAKRGVKVSVVGVPKTIDNDILLLDKTFGFDTAVE
EAQKAILAAATEAQSAYRGVGVVKLMGRQSGFITMFATLANGQVDCCLIPETTWAAHGPN
GVINYVRNLLDTQGHAVVVLAEGAGQEFVTSTGVDAGGNPKLGDIGQWFCKQLKSELKCD
IKYIDPTYMVRGCQANAHDSIMCTVLGQNAVHGAFAGFTGISVGTVSAHTAYLPIPRMIE
HERLVDPDGRMWHRTLESTGQPDFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgagttcggtcgagcgttaaacaagacgacgacgacgaccgcacgcgcgtcc
gcggagtccgcgatcgacgccagactcgagggcgatgatgatgagtcagaagacgacgcg
ttttactcgtggcgcgtgggtggggcgaacgacttgaagatcacgcacttgcgggacgtg
tacaggggcgacgtcccgctcgtcgcccaaccgagtccgttttgtacgacgacggcgtgc
ccgctgagcggacctcgaacgtcggtcgagttcaattcaaactttgtgagcaacagcgat
cgggtcttgttgaactcggtggcctttggatcgtccgcagatccgacgcagacgtgctcg
ttgtgggcggagacgttcgacccaaacgggtgtgactacgtcccgcagtgggtcgtccga
gccgggccgcgatcggaggtatacttcgactcagacgaggtacatgctgcgattgtaacc
tgtgggggtctgtgcccggggatcaacgatgtgattcgatcgctcgtgaacacgttggag
gtcggttacggagtgaagaagatcagcggcatccgctacgggttcaagggcttcttctcg
ggcgttgagttcatgaagctgaataaaaagactgtgaggaacattcacaccctcggtggt
tctatgcttggctccggtcgaggcggtggggacgtgcagaagattgtggagtccatcatc
catcacggaatcaatatggttttcgtcatcggcggtaatggaacgcacgcaggggcaaat
gccattagcgacgagtgcgccaagcgaggcgttaaagtctccgttgtgggcgtgccgaag
acgatcgacaacgatattttactcttagataagacgttcggcttcgataccgcggttgag
gaggcacaaaaagcaatcttagccgcggcgactgaggcccagagcgcgtaccgcggcgtc
ggcgtcgtcaagctcatgggacgtcagagtggattcatcaccatgttcgccactttagca
aacggacaggtcgactgttgtttgatcccggagacgacttgggctgctcacggaccgaac
ggcgtgataaactatgtacgaaaccttctggatactcagggacacgccgtcgtcgtcctc
gccgagggcgccggtcaagagttcgtcacctctaccggcgtcgacgctggtggcaacccc
aagctcggtgacatcggccagtggttctgcaagcagctcaaatccgaactcaagtgcgac
atcaagtacatcgatcccacctacatggttcgcggctgccaggcgaacgcccacgactcc
atcatgtgcaccgtgctcgggcaaaacgccgtgcacggcgccttcgctggattcaccggc
atctctgtcggcaccgtcagcgcccacaccgcgtatctacctatcccacgcatgatcgag
cacgagcgcctggtcgaccccgacggcaggatgtggcacagaacgctcgagagcacgggc
caaccagacttcttctaa

DBGET integrated database retrieval system