KEGG   Ostreococcus tauri: Ot14g02170Help
Entry
Ot14g02170        CDS       T01358                                 

Definition
putative pyrophosphate-fructose-6-phosphate 1-p (ISS)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ota  Ostreococcus tauri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ot14g02170
   01230 Biosynthesis of amino acids
    Ot14g02170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ot14g02170
   00030 Pentose phosphate pathway
    Ot14g02170
   00051 Fructose and mannose metabolism
    Ot14g02170
   00052 Galactose metabolism
    Ot14g02170
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ot14g02170
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ot14g02170
Protein phosphatases and associated proteins [BR:ota01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ot14g02170
Messenger RNA biogenesis [BR:ota03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ot14g02170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
14
AA seq 505 aa AA seqDB search
MDFEFGRALNKTTTTTARASAESAIDARLEGDDDESEDDAFYSWRVGGANDLKITHLRDV
YRGDVPLVAQPSPFCTTTACPLSGPRTSVEFNSNFVSNSDRVLLNSVAFGSSADPTQTCS
LWAETFDPNGCDYVPQWVVRAGPRSEVYFDSDEVHAAIVTCGGLCPGINDVIRSLVNTLE
VGYGVKKISGIRYGFKGFFSGVEFMKLNKKTVRNIHTLGGSMLGSGRGGGDVQKIVESII
HHGINMVFVIGGNGTHAGANAISDECAKRGVKVSVVGVPKTIDNDILLLDKTFGFDTAVE
EAQKAILAAATEAQSAYRGVGVVKLMGRQSGFITMFATLANGQVDCCLIPETTWAAHGPN
GVINYVRNLLDTQGHAVVVLAEGAGQEFVTSTGVDAGGNPKLGDIGQWFCKQLKSELKCD
IKYIDPTYMVRGCQANAHDSIMCTVLGQNAVHGAFAGFTGISVGTVSAHTAYLPIPRMIE
HERLVDPDGRMWHRTLESTGQPDFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgagttcggtcgagcgttaaacaagacgacgacgacgaccgcacgcgcgtcc
gcggagtccgcgatcgacgccagactcgagggcgatgatgatgagtcagaagacgacgcg
ttttactcgtggcgcgtgggtggggcgaacgacttgaagatcacgcacttgcgggacgtg
tacaggggcgacgtcccgctcgtcgcccaaccgagtccgttttgtacgacgacggcgtgc
ccgctgagcggacctcgaacgtcggtcgagttcaattcaaactttgtgagcaacagcgat
cgggtcttgttgaactcggtggcctttggatcgtccgcagatccgacgcagacgtgctcg
ttgtgggcggagacgttcgacccaaacgggtgtgactacgtcccgcagtgggtcgtccga
gccgggccgcgatcggaggtatacttcgactcagacgaggtacatgctgcgattgtaacc
tgtgggggtctgtgcccggggatcaacgatgtgattcgatcgctcgtgaacacgttggag
gtcggttacggagtgaagaagatcagcggcatccgctacgggttcaagggcttcttctcg
ggcgttgagttcatgaagctgaataaaaagactgtgaggaacattcacaccctcggtggt
tctatgcttggctccggtcgaggcggtggggacgtgcagaagattgtggagtccatcatc
catcacggaatcaatatggttttcgtcatcggcggtaatggaacgcacgcaggggcaaat
gccattagcgacgagtgcgccaagcgaggcgttaaagtctccgttgtgggcgtgccgaag
acgatcgacaacgatattttactcttagataagacgttcggcttcgataccgcggttgag
gaggcacaaaaagcaatcttagccgcggcgactgaggcccagagcgcgtaccgcggcgtc
ggcgtcgtcaagctcatgggacgtcagagtggattcatcaccatgttcgccactttagca
aacggacaggtcgactgttgtttgatcccggagacgacttgggctgctcacggaccgaac
ggcgtgataaactatgtacgaaaccttctggatactcagggacacgccgtcgtcgtcctc
gccgagggcgccggtcaagagttcgtcacctctaccggcgtcgacgctggtggcaacccc
aagctcggtgacatcggccagtggttctgcaagcagctcaaatccgaactcaagtgcgac
atcaagtacatcgatcccacctacatggttcgcggctgccaggcgaacgcccacgactcc
atcatgtgcaccgtgctcgggcaaaacgccgtgcacggcgccttcgctggattcaccggc
atctctgtcggcaccgtcagcgcccacaccgcgtatctacctatcccacgcatgatcgag
cacgagcgcctggtcgaccccgacggcaggatgtggcacagaacgctcgagagcacgggc
caaccagacttcttctaa

DBGET integrated database retrieval system