KEGG   Ostreococcus tauri: Ot15g00120Help
Entry
Ot15g00120        CDS       T01358                                 

Definition
Mitogen-activated protein kinase (ISS)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ota  Ostreococcus tauri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
15
AA seq 424 aa AA seqDB search
MAHVRSDRGIAAGWFARDDAGERARAGAGGRDARVGGGDRDSVWANCMEDETTDKYTRGA
RTTWVGRHAFDVDERYNPLKIIGRGAYGVVCSAIDGAPMARGRVGTSRRVAVKKLTNCFD
SPVEARRALREVHLLRRLRHENVIKLVDVMMPTNEIGRVSDVYLVYELMDTDLHQIIRSD
QTLLDEHCQYFMYQILRGLKYVHSANVLHRDLKPSNILLNANCDLCICDFGLARSMVEEG
HMMTSYVVTRWYRAPELLLNSEEYAASIDMWSVGCILAEIIARKPLFPGKDFIHQMHLII
ETLGSPEEADLEFISSSYARKYIGALPRKPKIDFASLYPRANVLAVDLLERILVFNPHRR
ISVDEALAHPYLASLHDVSAEPRYAADPSDLHHDPLDDPDVHVPDEHLRDALRNQMLAVK
AANW
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgtgcggagcgatcgagggatcgccgcggggtggttcgcgcgcgacgacgcg
ggcgaacgcgcgcgcgcgggcgcgggcggtcgagacgcgcgggtcggtggcggtgaccga
gactccgtgtgggcaaactgtatggaagacgaaacgacagataaatacacccgcggcgcg
cgcacgacgtgggtcggacgacacgcgttcgacgtcgacgagaggtacaacccgctgaag
atcatcggacgcggggcgtacggggtggtgtgctcggcgatcgacggcgcgccgatggct
cgcgggcgcgtcgggacgtctcgccgggtggcggtgaagaagctgacgaattgctttgat
tcgcccgtcgaggcgagacgggcgcttcgagaggtgcatctcctgcgtcgacttcgacac
gagaacgtgatcaaactcgtggacgtgatgatgccgacgaacgagatcggtcgcgtgagc
gatgtctacctcgtgtacgagctcatggacaccgatctgcaccaaatcatacggagcgat
caaacgctcctggacgagcactgtcagtactttatgtaccaaatcttgcgagggctcaag
tacgtgcacagcgcaaacgtgctccatcgcgatctgaagccgagtaatatcttgctcaac
gcgaactgtgatctgtgcatatgcgacttcggtctcgcgcgaagcatggtcgaggaggga
cacatgatgacttcgtacgtcgtcacgcgatggtaccgcgccccggagctgttgctcaac
tctgaggagtacgcggcgtcgatcgatatgtggtccgtcggatgcatcttggccgagatc
atcgctcgaaaacctttgttcccggggaaggatttcatccatcagatgcacctcatcatc
gaaaccttgggttctcctgaagaggcggatctcgaattcatctcttcgtcgtacgcgcgc
aagtacatcggcgctctcccgcgcaagccaaagatcgacttcgcgtcgctctatccgcgc
gccaacgtcttggccgtcgatctcctcgagcgtatattggtcttcaacccgcatcgtcga
atcagcgtcgacgaagccctggcgcatccgtacctggcgtctctccacgacgtctccgcc
gagccgcggtacgcggcggatccgagcgatctccaccacgatcctctggacgaccccgac
gtgcacgtccccgacgaacacctccgcgacgctctgagaaaccaaatgctcgccgtgaag
gctgccaactggtga

DBGET integrated database retrieval system