KEGG   Ostreococcus tauri: Ot15g00340Help
Entry
Ot15g00340        CDS       T01358                                 

Definition
Serine/threonine specific protein phosphatase PP1, catalytic subunit (ISS)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ota  Ostreococcus tauri
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ota00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Ot15g00340
Enzymes [BR:ota01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Ot15g00340
Protein phosphatases and associated proteins [BR:ota01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Ot15g00340
Transcription machinery [BR:ota03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Ot15g00340
Spliceosome [BR:ota03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Ot15g00340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
15
AA seq 285 aa AA seqDB search
MEIFLAQPCLLELEAPLKICGDVHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQGLE
VICLLLAYKVKYPENFFLLRGNHECNSISRIYGFYDECKRRYNIKLWRVFCDVFNCLPFA
AIVDEKIFCIHGGPSPELKDLQQIVQIKRPTDIPDMGMLCDFLWSDPDADIQGWGENDRG
VSYTYGTDVVGDFLAKFDFDLVVRAHQVVENGYEFFGKRQLVTVFSAPNYCGEFDNAGAM
MTVDENLMCSFQILKPAERKLMGGFGSMMGARPSTPPRNAGGGGK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttccttgcgcagccgtgtttgcttgagctggaggcgcctttgaagatttgc
ggggatgtacacggacagtattcggacttgttgaggttgttcgaatacggcgggtttccg
ccggaggcgaactatttgttcttgggggattacgttgatcgcggaaagcaaggtttggag
gtgatatgtttgctcctggcatacaaggtgaagtatccggagaactttttcttgctcaga
ggtaaccacgaatgcaactcgatcagtagaatctacggattctacgacgagtgcaagcgg
cggtacaacataaagctttggcgcgtgttttgcgacgtgttcaactgcttgcccttcgct
gcaattgtggacgaaaagatcttttgcatccacggtggaccgagtccagagcttaaggac
ttgcagcagatagttcaaatcaagaggccgacggatatcccggacatggggatgctctgt
gactttttgtggagcgatccagacgcagacatccaaggctggggagagaacgatcgaggc
gtttcgtacacttacggcacagacgtcgtcggcgatttcctcgccaagtttgatttcgac
ttagtggttagagcgcatcaggtggtggagaatggttacgaatttttcggtaagcgtcaa
ctcgttacggtgttctctgctcccaactactgtggagagttcgacaatgccggcgcgatg
atgacagtggacgaaaacttgatgtgcagcttccaaattttgaagcccgccgagcgtaag
ctcatgggtggtttcggtagtatgatgggtgcgcgtccgagcacgccgcctagaaatgcc
ggcggtggcggcaaataa

DBGET integrated database retrieval system