KEGG   Ostreococcus tauri: Ot15g00340Help
Entry
Ot15g00340        CDS       T01358                                 

Definition
Serine/threonine specific protein phosphatase PP1, catalytic subunit (ISS)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ota  Ostreococcus tauri
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:ota03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
15
AA seq 285 aa AA seqDB search
MEIFLAQPCLLELEAPLKICGDVHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQGLE
VICLLLAYKVKYPENFFLLRGNHECNSISRIYGFYDECKRRYNIKLWRVFCDVFNCLPFA
AIVDEKIFCIHGGPSPELKDLQQIVQIKRPTDIPDMGMLCDFLWSDPDADIQGWGENDRG
VSYTYGTDVVGDFLAKFDFDLVVRAHQVVENGYEFFGKRQLVTVFSAPNYCGEFDNAGAM
MTVDENLMCSFQILKPAERKLMGGFGSMMGARPSTPPRNAGGGGK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttccttgcgcagccgtgtttgcttgagctggaggcgcctttgaagatttgc
ggggatgtacacggacagtattcggacttgttgaggttgttcgaatacggcgggtttccg
ccggaggcgaactatttgttcttgggggattacgttgatcgcggaaagcaaggtttggag
gtgatatgtttgctcctggcatacaaggtgaagtatccggagaactttttcttgctcaga
ggtaaccacgaatgcaactcgatcagtagaatctacggattctacgacgagtgcaagcgg
cggtacaacataaagctttggcgcgtgttttgcgacgtgttcaactgcttgcccttcgct
gcaattgtggacgaaaagatcttttgcatccacggtggaccgagtccagagcttaaggac
ttgcagcagatagttcaaatcaagaggccgacggatatcccggacatggggatgctctgt
gactttttgtggagcgatccagacgcagacatccaaggctggggagagaacgatcgaggc
gtttcgtacacttacggcacagacgtcgtcggcgatttcctcgccaagtttgatttcgac
ttagtggttagagcgcatcaggtggtggagaatggttacgaatttttcggtaagcgtcaa
ctcgttacggtgttctctgctcccaactactgtggagagttcgacaatgccggcgcgatg
atgacagtggacgaaaacttgatgtgcagcttccaaattttgaagcccgccgagcgtaag
ctcatgggtggtttcggtagtatgatgggtgcgcgtccgagcacgccgcctagaaatgcc
ggcggtggcggcaaataa

DBGET integrated database retrieval system