KEGG   Ostreococcus tauri: Ot15g00410Help
Entry
Ot15g00410        CDS       T01358                                 

Definition
OJ000223_09.4 [Oryza sativa (ISS)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ota  Ostreococcus tauri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
15
AA seq 554 aa AA seqDB search
MPADGRTEPERRVAAIAEIVRALIADTGAGASKDSKRNGFGVNLNALKNSIARKHALSRS
PKLTELIAAVPVEHREALMPRLRAKPVRTASGVAVVAVMSKPHRCPHIATTGNVCVYCPG
GPDSDFEYSTQSYTGYEPTSMRAIRARYDPYAQSRGRVDQLRRLGHAVDKVEFVLMGGTF
MSLPTDYRDYFIRNLHDSLSGASSSCVDEAVRASEQSRTKCVGLTIETRPDYCQSPHLRQ
MLSYGCTRLEIGLQSIYEDVARDTNRGHTVAAVQKCFELAKDAGFKVIAHMMPDLPNVGM
ERDLESFREFFESPDFRTDGLKLYPTLVIRGTGLYELWRTGKYRNYHPERLVDLVARILA
LVPPWVRVYRVQRDIPMPLVTAGVEKGNLRELAMARMADLGLRCRDVRTREVGLQDIHNR
VAPTHVELVRRDYVANGSWETFLSYEDPRQDILVGLLRLRKCGRTAAKTSPVLKGKCSMV
RELHVYGTAVAVHSRDKGRFQHRGYGTLLMREAERIAREEHGSAKLAVISGVGTRHYYRK
LGYELEETYMVKQL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggacgggcgcaccgagcccgagcggcgcgtcgccgcgatcgccgagatcgtc
cgcgccctgatcgcggacacgggcgcgggcgcgtcgaaggattcgaagagaaatggattc
ggtgtcaacctgaacgcgttgaaaaactcgatagctcgcaagcacgcgctgtcgagatcg
ccgaaactcaccgaactcatcgcggcggtgccggttgagcatcgtgaggcgctgatgccg
cgcctgagggcgaaaccggtgcggacggcgagcggggtcgcggtggtggcggtgatgagc
aaaccgcaccggtgcccgcacatcgcgacgaccgggaacgtgtgcgtgtactgcccgggt
ggaccggattcggattttgaatattcgacgcagtcgtacaccgggtacgagccgacgtcg
atgcgagcgattcgtgcgaggtacgacccgtacgcgcagagccgaggacgggtcgatcag
ttgcggaggttgggccacgcggtggataaagtggaatttgtattgatgggagggacgttc
atgagcttgccgaccgattacagggattatttcatcaggaatttacacgattccctgagt
ggggcgtcgagctcgtgcgtggacgaagctgtgagggcgtcagagcagagtcggaccaag
tgcgtgggcttgacgatcgagacgcgaccggattattgtcagtccccgcatctgcgtcag
atgctctcttacgggtgcacgcgattggagataggattacagagcatatacgaagacgtc
gctcgagacaccaatcgcgggcacaccgtggcggcggtgcaaaagtgtttcgagttggcg
aaagacgcggggttcaaagtcatcgcgcacatgatgccagacctcccgaacgtagggatg
gagcgcgacttggagtcgtttcgcgagttttttgaatcgcccgatttcagaacggacggt
ttgaagctctaccccacgctcgttatcagaggcaccgggttgtacgaactctggcgcacg
ggcaagtatagaaattatcatccggagcgactcgtagatttggtcgctcgtatcctcgcc
ctggtcccaccgtgggttcgagtgtatcgagtgcagagagacattccgatgcctctcgtc
accgctggagtggagaaagggaacctgcgcgagctcgccatggcgcgcatggccgatttg
ggactgcgatgcagagacgtgcgaacgcgcgaggtcggtttgcaggacatacacaatcgc
gtcgctccaacccacgttgagctcgtgcgacgagattacgtcgccaacggaagttgggag
acgttcttgtcctacgaggaccctcgacaggacattctcgtcggtctccttcgtcttcgt
aagtgcggacgaaccgccgccaagacgtcaccggtgctcaagggcaagtgttcaatggtg
cgcgagcttcacgtctacggcaccgccgtcgccgtacactcgcgagataagggacgattc
caacaccgaggctacggcactcttctcatgcgcgaggctgagcgcatcgctcgcgaggag
cacggctctgccaaactcgccgtcatatccggcgtcggcactcgacactactaccgaaaa
ctcgggtacgagctcgaggaaacgtacatggtcaaacaattatag

DBGET integrated database retrieval system