KEGG   Ostreococcus tauri: Ot15g01870Help
Entry
Ot15g01870        CDS       T01358                                 

Definition
Translation initiation factor 3, subunit b (eIF-3b) (ISS)
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ota  Ostreococcus tauri
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ota03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
15
AA seq 695 aa AA seqDB search
MDAIPSNFPRDEGARARGSAATLERWRRVMRERDDDGVGTMERLTERLMMDVSRAQDGFV
DWNKVDVESVELPRDEFERAGLDKPVEAEIEELKQESGFASVIVVDNLPMIAEAKYAKLL
SVLTKIFSQIGTIREGGLLMPQDDSKTSLGFAFIEYENEQQAQSAVDQTNGYQLDKKHVF
KVCKFDDFEKYEKVPDEYVAPPPKPFAKRENTQAWMMDQRGRDQFVCRFGDETEIFWNDP
QTKKGEDVYTRTHWTESYVQWSPKGSFLATVHRQGVALWGGESFGRIAKYAHNAVQFIEF
SPCERFLATGSTHEPSKAGETTQVLVNFFDTRSGAKLRTFTGPISDFIAEGQQGLTWPVF
KWAGQSNGKCGAFFAKIATGAISVYEAPEMTLVDKKSIKLPGVVDFCWSPADPILSCFQP
EQNGGNVPARLSLIGLPSKQEVRSKNLFNVVGVNMHWQSGGDYFAAKILRTTKSKKSTYS
GFELFRLREPNCPMEVLELPNKAEKIVAFAWEPKGHRFAIIHGDGARPDVSFYSMKDKQG
NNNCTLIGTIKNKTANHLFWSPNGRVVILAGLKTMNGQFEFFDVDAMDTMASVEHFMATD
VEWDPTGRFVTTAVTSVHQMENGYHKWTFNGKLLYKYGKDRFFQFLWRPRGKSLLSPEQE
ADIEKNIKKYSKRFEEIDEKIRNERIPALRARSAX
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcccttcaaacttccctcgggacgagggcgcgagggcgaggggatcggcc
gcaactctcgagaggtggagacgcgtgatgcgcgaacgcgacgacgacggggtgggaacg
atggagagactgacggagaggttgatgatggacgtttcacgcgcgcaggatggattcgtg
gattggaacaaggttgacgtggagtccgtggagctcccgcgcgacgagtttgagcgcgcg
ggtttggacaagcccgtggaggcggagatcgaggaattgaagcaagagagcggattcgcg
tcggttatcgtggtggataatctacccatgatcgccgaggcgaagtacgcgaagttgctg
agcgtgttgacgaagattttcagtcagattggaacgattcgagagggcgggttgttgatg
ccgcaggacgactcgaagacgtcgcttggtttcgcgttcattgagtatgagaacgagcag
caagcgcagagcgcggtggatcaaacgaacggctaccagttggacaagaagcacgtcttc
aaggtttgcaagtttgatgactttgagaagtacgaaaaggtgccggatgagtacgtcgcg
ccgccgcccaagccgttcgcaaaacgagagaacacccaggcttggatgatggaccagcga
ggtcgagatcagtttgtctgcagattcggtgacgagacagaaattttctggaacgatccg
cagacgaagaagggcgaggacgtgtacacgcgcacgcactggacggagtcgtacgtgcag
tggtcgccgaaggggagtttcttggccacggtgcacagacaaggagtcgcgctttggggg
ggcgaatcgttcggtcgcatcgccaagtacgcgcacaatgccgtccagttcatcgaattc
tctccgtgcgagcgttttcttgccactggttcgacgcacgaaccgagtaaggcgggtgaa
accacacaagtgcttgtcaactttttcgacacgcgctcgggcgccaagttgcgcacgttc
acgggaccgattagtgatttcatagcggaaggtcaacaaggtttgacctggccggtgttc
aagtgggccggtcagagtaacggcaagtgcggcgccttctttgccaagattgccacggga
gcgatttccgtgtatgaagctccggagatgaccttggtggacaaaaagtccatcaagctt
ccgggtgtggtcgatttctgctggtctccagcggatccgatcctatcgtgcttccagccc
gaacaaaacggcggtaacgtcccggcgcgtctctccttgattggcttgccgagtaagcag
gaagttcgttccaagaacttgttcaacgtcgtcggcgtcaatatgcactggcaatctggc
ggtgattacttcgcggcaaagattttgcgcacgaccaagtcgaaaaagagcacatacagc
ggcttcgaactgttccgattgcgcgagccgaactgcccgatggaagttctcgaactcccg
aacaaggctgaaaagattgtcgcgtttgcatgggagccaaagggtcatcgcttcgccatc
atccacggcgacggcgcgcgtccggacgtctccttctacagcatgaaggataaacaaggc
aacaacaactgcacgcttatcggtaccatcaagaacaagacggctaaccacttgttctgg
agcccgaatggccgcgtcgtcattttggctggcttgaagacgatgaatgggcagttcgaa
ttcttcgacgtagacgccatggataccatggcatccgtcgagcacttcatggccactgac
gttgaatgggaccctaccggtcgcttcgtcaccactgcggtgacgagcgttcaccagatg
gagaatggttaccacaagtggactttcaacgggaagcttctctacaagtatggcaaggat
cgcttcttccagttcttgtggcgtcctcgcgggaagagtctactctcccccgagcaagag
gccgatatcgaaaagaacatcaagaaatacagcaagaggttcgaagagatcgacgagaag
atccggaacgaacggattccagcgctgcgagcgagaagcgcnnnn

DBGET integrated database retrieval system