KEGG   Ostreococcus tauri: Ot16g01770Help
Entry
Ot16g01770        CDS       T01358                                 

Definition
6-phosphogluconolactonase-like protein (ISS)
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
ota  Ostreococcus tauri
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ot16g01770
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ot16g01770
Enzymes [BR:ota01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Ot16g01770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
16
AA seq 255 aa AA seqDB search
MGATTTRTTYVETSEGCADALVAVVKNASARAIASRGTFSIALAGGSLIRMLGALKKADA
EVEFGKWVVFWVDERCVKWADAESNFGGAKRALFDDVDVPKSSLFAIDETLCETNAGAAI
PCAEAYEKDLRALTPHAIELDANGLPVFDMLLLGFGPDGHICSLFPNHELLKATDGWILP
ITDSPKPPPERVTFSLPVVNAAREKVFVASGEGKAEMTARILEEAPQDGSIPAALVTGNV
RWIIDAAAASKMRNK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgacgacgacgcggacgacgtacgtggagacctcggagggatgcgccgatgcg
ctcgtggcggtggtgaagaatgcgagcgcgagggcgatcgcgtccagggggacgttctcg
atcgcgctcgcgggtgggtcgttgattcggatgctcggcgcgctgaaaaaggcggacgcg
gaggtggagttcgggaagtgggtcgtgttttgggtggacgagcgctgcgtgaagtgggcg
gatgcggagagtaatttcggtggagctaaacgggcgctgttcgatgacgtggacgtgccg
aaatcgtcgctgtttgcgatcgacgagacgctgtgcgagacgaatgccggcgcggcgatt
ccatgcgccgaggcgtacgagaaggatctccgagcgttgacaccgcacgcgatcgagctc
gacgcgaatggactgcctgttttcgacatgctcttacttggtttcgggccggacggacat
atctgctcgttgttccccaatcacgagctcttgaaggcgacagatgggtggattttgccc
ataaccgattcgccgaaaccgccgcccgagcgcgtgacattctcattacccgtggtgaac
gcggcgcgggagaaggtgttcgttgcctcgggcgagggtaaggcggagatgactgctcgt
atcttagaagaagctccacaggacggttcgattcctgcagctctggtcacgggcaacgtg
cggtggatcatcgacgccgccgccgcgtcaaagatgcgcaacaaatga

DBGET integrated database retrieval system