KEGG   Ostreococcus tauri: Ot16g01770Help
Entry
Ot16g01770        CDS       T01358                                 

Definition
6-phosphogluconolactonase-like protein (ISS)
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
ota  Ostreococcus tauri
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ot16g01770
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ot16g01770
Enzymes [BR:ota01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Ot16g01770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
16
AA seq 255 aa AA seqDB search
MGATTTRTTYVETSEGCADALVAVVKNASARAIASRGTFSIALAGGSLIRMLGALKKADA
EVEFGKWVVFWVDERCVKWADAESNFGGAKRALFDDVDVPKSSLFAIDETLCETNAGAAI
PCAEAYEKDLRALTPHAIELDANGLPVFDMLLLGFGPDGHICSLFPNHELLKATDGWILP
ITDSPKPPPERVTFSLPVVNAAREKVFVASGEGKAEMTARILEEAPQDGSIPAALVTGNV
RWIIDAAAASKMRNK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgacgacgacgcggacgacgtacgtggagacctcggagggatgcgccgatgcg
ctcgtggcggtggtgaagaatgcgagcgcgagggcgatcgcgtccagggggacgttctcg
atcgcgctcgcgggtgggtcgttgattcggatgctcggcgcgctgaaaaaggcggacgcg
gaggtggagttcgggaagtgggtcgtgttttgggtggacgagcgctgcgtgaagtgggcg
gatgcggagagtaatttcggtggagctaaacgggcgctgttcgatgacgtggacgtgccg
aaatcgtcgctgtttgcgatcgacgagacgctgtgcgagacgaatgccggcgcggcgatt
ccatgcgccgaggcgtacgagaaggatctccgagcgttgacaccgcacgcgatcgagctc
gacgcgaatggactgcctgttttcgacatgctcttacttggtttcgggccggacggacat
atctgctcgttgttccccaatcacgagctcttgaaggcgacagatgggtggattttgccc
ataaccgattcgccgaaaccgccgcccgagcgcgtgacattctcattacccgtggtgaac
gcggcgcgggagaaggtgttcgttgcctcgggcgagggtaaggcggagatgactgctcgt
atcttagaagaagctccacaggacggttcgattcctgcagctctggtcacgggcaacgtg
cggtggatcatcgacgccgccgccgcgtcaaagatgcgcaacaaatga

DBGET integrated database retrieval system