KEGG   Ostreococcus tauri: Ot16g02030Help
Entry
Ot16g02030        CDS       T01358                                 

Definition
putative isopentenyl monophosphat (ISS)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ota  Ostreococcus tauri
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ot16g02030
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Ot16g02030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
16
AA seq 351 aa AA seqDB search
MSLARASSLSAQTSARAHTGRKNRTQNYPSRSDRSVTRITPRGSLARALAADGIDVREYF
SPSKINLFLRITARRPDGFHELASLFHVVDLGDGMKFAKSSSETKDTLICSDASIPTDES
NLVIKALNLFRKKTGIEQYFWVELDKRVPHGAGLGGGSGNAATTLFAANELCGNPASEAE
LLEWSGEIGSDISVFFSNGAAYCTGRGEIVDNVEPPLDLGTKMLLVKPPMGCSTPAVFKA
LDLDSRSTADPLELLKRIGSDGCSEAVCINDLEAPAFKVLPELAELKAELTEATKDKGTV
VFMSGSGSTIVIIGDDDVPAFVAADETLFKAPTRLITRKSGEWYAPTLERK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgcacgcgcgtcgtctctgagcgcccaaacgtccgcgcgcgcgcacacggga
cgtaaaaatcgcacacaaaactatccgtcccgaagcgatcgttcagtcactcgcatcacc
ccgcgcgggtcgctcgcgcgggcgctcgcggcggacggcatcgacgtccgagagtacttc
tcgccgtcgaagatcaatctcttcctgagaatcaccgctcgaagaccggatgggttccac
gagttggcgtcgctgttccacgtcgtcgacctgggcgacgggatgaagtttgcaaagtcg
tcgagcgagacgaaggacacgctgatctgttcggacgcgagcataccgacggacgagagt
aatttagtgatcaaggcgttgaatctgttcagaaagaagacggggatcgagcagtacttt
tgggtggagctggataagagagtgccgcacggcgcgggtttgggcggcggaagcggaaac
gcggcgacgacgctcttcgccgcgaacgagctctgtgggaacccggcgagtgaggcggag
ttgttggagtggagtggggagattgggagtgatatctcggtgttcttttccaacggtgcg
gcgtattgcacggggagaggggaaatcgtggacaacgtcgagccgccgttggatctcggg
acgaagatgctcttggtgaaaccgccgatgggatgttcaacgccagcggtgttcaaagcc
ttggacctcgactcacgatcgaccgcggatccgctggaactgttgaagcgaatcgggagc
gatgggtgctcggaagcggtgtgcattaacgatctcgaagcgcccgcgttcaaggttctc
ccggagctcgccgagttaaaggcggagctcaccgaggcgaccaaggacaagggaacggtg
gtgttcatgtcaggaagcgggagcactatcgtgatcatcggtgacgatgacgttcccgcg
ttcgtcgccgcggacgagacgttgttcaaggcgccgacgcgattgatcacgaggaagagc
ggtgagtggtacgcgccgacgctcgagcgaaagtga

DBGET integrated database retrieval system