KEGG   Ostreococcus tauri: Ot17g00700Help
Entry
Ot17g00700        CDS       T01358                                 

Definition
palmitoyl-protein thioesterase precursor (ISS)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ota  Ostreococcus tauri
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Ot17g00700
  Lipid metabolism
   00062 Fatty acid elongation
    Ot17g00700
Enzymes [BR:ota01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Ot17g00700
Lipid biosynthesis proteins [BR:ota01004]
 Fatty acid synthase
  Component type
   Ot17g00700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
17
AA seq 325 aa AA seqDB search
MGRLARAFASAIALIHDKRASSVQVGFVSVGTSCEERFDDSSTTRVENAIVFWHGMGDVG
DASGTLAVMDAAVKTLGSETTCARSLRFGASARADRMSGYTGDVDAQVGAACDAMRADDA
IGRARSVHVVGFSQGGQFMRALVQRCGRELGVRTLVTLGGQHMGVDAVPGCGDPERASMA
CQAMNDAASYASASAWARRTVVQAQYFRDTSTHARYNRYLATNRANENARNREALTSLER
FVMFMFEEDDMVSPKESSWFGSRVVAGANRTKIIPYYENESIYAALGLDALDRDNRIEMR
LIPGAQHMQFTVDWFVSEIVKKYWL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgggccgactcgctcgcgcgttcgcctccgcgatcgcgctgatccacgacaagcgcgcg
tcgtccgtccaggtcggtttcgtgagcgtcgggacgtcgtgcgaggagcgattcgatgat
tcgtcgacgacgcgagtagagaatgcgattgttttctggcacggcatgggggacgtcggc
gacgcctcggggacgctcgcggtgatggacgccgcggtgaagacgttagggagcgagacc
acgtgcgcgcgatcgctgcggttcggtgcgagcgcgagagcggatcgaatgagcggatac
acgggtgacgtggacgcgcaggtgggcgcggcgtgtgacgcaatgcgagccgacgatgcg
attgggagagcgcgatcggtgcacgtggtcgggttctcgcagggtggacagttcatgcgc
gcgttggtgcagcggtgtgggcgagagctcggggtgcgaacgttggtgacgctcggtggc
cagcacatgggcgtggacgcggttccagggtgcggcgatcccgagcgggcgtccatggct
tgtcaagcgatgaacgacgcggcgtcatacgcaagcgcgagcgcgtgggcgaggagaacc
gtggtgcaggcgcaatattttagggatacgtccacgcacgcgaggtataaccgatacttg
gccacgaaccgagcgaacgagaacgcgaggaatcgtgaggcgttgacctcgctcgagcga
ttcgtgatgttcatgttcgaagaggacgacatggtgagcccgaaggagagctcgtggttc
ggctcaagagttgtcgccggggcaaaccgaacgaaaattattccatactacgaaaacgag
agcatctacgccgcgctcggtctggatgctctcgatcgcgataatcgcatagagatgaga
cttatcccaggggcacagcacatgcagttcaccgtcgattggttcgtcagcgagatcgtt
aaaaagtattggttatga

DBGET integrated database retrieval system