KEGG   Ostreococcus tauri: Ot19g00200Help
Entry
Ot19g00200        CDS       T01358                                 

Definition
Galactosyltransferases (ISS)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
ota  Ostreococcus tauri
Pathway
Metabolic pathways
Brite
Enzymes [BR:ota01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     Ot19g00200
Glycosyltransferases [BR:ota01003]
 Glycan extension
  Type 3 chain
   Ot19g00200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
19
AA seq 313 aa AA seqDB search
MATRTRFMRKRFSPRALAAKLLPLTLGVLASQLYSLKFDDVRVKTARTRDAYPSVACWIL
RANTPRDLARGDAIRRGWGKTCAHLEFIDRDTPGIRVDWTETYDALSAKSWRAWTFMYEK
YANASFANATRVDFVLKADTDTYVHGAHLLRYLNRFDATLPHYIGRQFVERGVAFVAGAT
IVLSREALRLVTVASRDGVGACARGKFTATKAEDVALALCLRDVGVYPHNSRDASGAERF
MVFSPQRMRAGSEGLPRWYVKRSLSAKQGPGCCSDEAISFHYVSTDELARARLVRVHGAW
SWTPAVASEPPPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcgacacgcacccgattcatgaggaaacggttctctccgcgcgcgctcgcggccaag
ctcctaccgctcacactcggcgttctcgcgtcgcagttgtattcgctcaagtttgacgat
gttcgcgtgaagactgcgcgtacgcgcgacgcgtatccttccgtcgcgtgctggatctta
cgagcgaacacaccgcgagatctggcgcgcggcgacgcgattcgtcgcggatggggcaag
acgtgcgcgcacttggagtttatcgatcgcgacacgcctggaatacgcgtcgattggacg
gagacctacgacgcgttatcggcgaagagttggagggcgtggacgttcatgtacgagaag
tacgcaaacgcgtcgttcgcgaacgcgacacgcgtcgatttcgtgttaaaggcggatacc
gatacgtacgtgcacggcgcgcacttgttgcggtatttaaatcgtttcgacgcgacgttg
ccgcattacatcggtcgacaattcgtcgagcgcggcgtcgcgttcgtcgccggcgcgacc
atcgtgctcagtcgagaggcgttgcgactcgtcaccgtggcgagtcgcgacggcgtgggc
gcgtgcgcgcggggaaaatttacggcgacaaaggctgaggacgtcgcgttagcgttgtgc
cttcgagacgtgggcgtgtatccacacaactcgcgcgacgcctcgggggcggagcggttc
atggtgttcagtccgcagcgcatgcgcgctggatccgaaggcttaccgcgctggtacgtc
aaacgaagcttgagcgcaaagcaaggtccggggtgctgcagtgacgaggcgatctctttc
cactacgtctcgacggacgaactcgcgcgcgcgcgactcgttcgcgtgcacggcgcgtgg
tcgtggactcccgccgtcgcgtcagagcccccaccgccatga

DBGET integrated database retrieval system