KEGG   Opitutus terrae: Oter_0342Help
Entry
Oter_0342         CDS       T00689                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ote  Opitutus terrae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Oter_0342
Enzymes [BR:ote01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Oter_0342
Exosome [BR:ote04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Oter_0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
408519..411083
Genome map
AA seq 854 aa AA seqDB search
MATVPVRFTYYTSVGGEAFPGHVALLTGNWDAAGRASPDWTRRPMERFVADDGGTAFRAT
VEFDAAEVGHVFHWGVVLRDPAGRERWAIATETPDVDRIERHRTFTLTAAPGSEDYYLAH
CRRLGSHKRHGGAHAAARFAVWAPNARRVDVVFAAVWSTDDPTRTPTRASLPIDKICGGY
IADDGTGIDPALPVLALQRGSGGVWETDPHDPALARFADFRHRAYLFRIEQEDGRVAYRT
DLYSRCQLGYGRTNPAKATPGQPWLGPISTLDGGVSCTTVVDLDEVTRDFVEQDQVWPER
VTIPADEFWADEFTGRKVPTRVEDLIIYELHVGALGFGHAGPGTLQDAMELLDHLSALNV
TAVELLPMCEFGGAAENWGYATSHFFAIEYSEGGRDQYKHFIKECHRRGLAVIVDMVYNH
FAHEAERAEYHYDSSAPENDIYYWYEGRATDYQRPDGTPFPEGGYVDNLSTAFAPRYSEE
MVRKLFISSAVALVREFHVDGLRLDQTTSIHAYNVLHADGRPVGAANAFGAKLLRELGRT
VRMFNPDAILIAEDHSTWDQVTRPVDEDGMGFDARWYADFCHHLAGDTDKGADYAKLIYH
AALLGAGAPAQLDYFAGALAASRLQAVVYAESHDEAGNSKGPFFDPTATDADKQHTSHRS
LVVASNEASLIGPTRAYAEARCRYEWGVTVLSAGTPMLLFGQECGAVQRFKYNAVLAERE
DLATLRSGTGAALVRFFADLNRLRRDHSALRSRNIDVLHVHNANRVLAWKRWDDAQSFLI
VASLNDAAFDRGYTIEHPHIEPGTWREIFNSDSRHYGGADVGNGGGSIWTGGGRFSAVLP
FAGFVVFAHERNQP
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggccactgttcctgtccgcttcacctattacaccagcgtcggtggcgaggctttcccc
ggacacgtcgcgctgctcaccggcaactgggatgcggccggccgcgcttcgccggactgg
acgcgccggccgatggagcgattcgtcgcggacgatggcggcaccgcttttcgcgccacg
gtcgagttcgacgccgcggaagtgggacacgtttttcactggggcgtcgtgctgcgcgat
cccgcgggtcgtgaacgctgggcgatcgccaccgaaacgccggacgtcgaccggatcgag
cgacatcggaccttcacgctcaccgccgcgcccggcagcgaggactactacctggcgcac
tgccgccggctcggctctcacaagcggcacggcggcgcgcacgcggccgcgcgcttcgcg
gtctgggcgccgaacgcccgccgcgtcgacgtcgtgttcgccgcggtctggagcacggat
gatccgacgcgcacgccgacgcgggcctcgctgccgatcgataaaatctgcggcggctac
atcgcggacgatggcaccggcatcgatcccgcgttgccggtgctcgcgttgcagcgcgga
tcgggcggcgtgtgggaaacggatcctcacgatcccgcgctcgcgcgcttcgccgatttc
cgccatcgcgcctatttgtttcgcatcgagcaggaggacggacgcgtcgcctatcgcacc
gacttgtattcacgctgccagctcggttacggccgcaccaacccggccaaagccacgccc
gggcagccgtggctcgggccgatctcgacgctcgacggcggcgtgagctgcacgacggtg
gtggaccttgacgaagtgacgcgtgatttcgtcgagcaggaccaggtctggcccgagcgc
gtcacgattcccgcggacgagttctgggccgacgaatttaccggacgcaaggtgccgacg
cgggtcgaggacctgatcatctacgagcttcacgtgggcgcgcttggcttcggccatgcg
ggacccggcacgctgcaggatgccatggagctgctcgatcacctctcggccctgaacgtc
actgccgtggagctgctgccgatgtgtgagttcggtggtgccgcggagaactggggctat
gccacgtcgcatttcttcgcgatcgaatacagcgaaggcggccgcgaccaatacaagcac
ttcatcaaggagtgccatcgccgcgggctcgcggtgatcgtcgacatggtttacaaccac
ttcgcccacgaagccgagcgcgcggaataccactacgattcgagcgcgccggagaacgac
atttactactggtatgagggccgggccacggactatcagcggcctgacggcactccgttc
ccggaaggcggctacgtcgacaacctctcgaccgcgttcgcgccgcgctactccgaggag
atggtgcgaaagctgttcatcagcagcgcggtcgcactggtgcgcgaatttcacgtggac
ggactgcggctggaccagaccacctcgatccacgcctacaacgtcctgcacgccgacggc
cgcccggtcggcgccgcgaatgcgttcggcgcgaagctgctgcgcgaactcgggcgtacc
gtgcggatgttcaaccccgacgcgatcctgatcgccgaggatcattcgacctgggaccag
gtcacgcggcccgtggacgaggatggcatgggcttcgacgcgcgctggtatgcggacttc
tgccaccatctcgccggcgacacggacaagggcgccgattacgcgaaactgatctatcac
gccgcgttgctcggcgccggcgcgcccgcgcagctcgactattttgcgggcgcgctcgcc
gcctcgcggttgcaggcggtcgtctacgccgagtcgcacgatgaggccggcaacagcaag
ggcccgtttttcgacccgaccgcgaccgacgccgacaagcagcacacgtcgcatcgctcg
ctggtcgtggcttcgaacgaagcgtcgctcatcggcccgacgcgcgcctacgccgaggcg
cgttgccgctacgaatggggcgtcaccgtgctctcggccggcacgccgatgctgctgttc
ggccaggaatgcggcgccgtgcagcggttcaaatacaacgccgtgctcgccgagcgcgag
gatctcgcgacgctgcggagcggcaccggcgccgccctcgtccggttcttcgccgacctc
aaccggctgcggcgcgatcactccgcgctgcgcagccggaacatcgacgtgctgcacgtg
cacaacgccaaccgcgtgctcgcgtggaagcgctgggacgacgcgcaatcgttcctcatc
gtcgcgagtctcaacgacgccgcgttcgaccgtggctacacgatcgagcacccgcacatc
gaacccggcacctggcgcgaaatcttcaacagcgactcgcgccactacggcggcgccgat
gtcggcaacggcggcggctcaatctggaccggcggcggccgattctcggcagttcttccg
tttgccgggttcgtcgtgttcgcgcacgaacgcaaccagccgtag

DBGET integrated database retrieval system