KEGG   Opitutus terrae: Oter_0429Help
Entry
Oter_0429         CDS       T00689                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ote  Opitutus terrae
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ote02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ote02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
503182..504267
Genome map
AA seq 361 aa AA seqDB search
MNRRIRVLIVDDSAVVRRLVTEALRADPEIEVVGTAADPYVARDRIKELDPDVLTLDLEM
PRMDGLTFLRILMDQHPMPVVIMSSLSQKGSDYALEALRLGAFDVLGKPSGAYSFGDLGA
QLIARVKAAGGARLRRPSTGTAAAPVRTAPRTGAASARQLILLGASTGGTEALREVLTRL
PAGLPPIAVVQHIPPVFSKAFADRLSAQCAFEVREAADGDMLKPGLALIAPGNFHLMVQW
HADHYRARVTTGPQIWHQRPAVDVLFKSAADCGAAPHAIAGVLTGMGKDGAEGLLRLRGL
GAITFAQDEASCVVYGMPRAAWENGAAQRQIPLDRIADFIVHPPSPPPPLSDASTLAPAL
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcgcatccgggtactcattgtcgacgactcggccgtcgtccgaagactcgtg
accgaggcgctgcgggccgatcccgaaatcgaagtggtcggcacggcggcggatccctac
gtggcgcgcgatcggatcaaggagctcgatcctgacgtgctgacgctggatctggaaatg
ccgcggatggatgggctgaccttcctgcggatcctgatggaccagcacccgatgcccgtg
gtgatcatgagctcgctttcccagaagggctcggactacgcgctcgaggcgctgcggctc
ggagccttcgacgtgctcggcaagccatcgggggcgtattccttcggcgacctcggcgcg
cagctgatcgcgcgcgtcaaggccgcgggcggcgcgcggctccggcggccgtcgaccggc
accgcggcggcgcccgtgcgcacggcgccgcgaaccggcgcggcctcggcgcggcagctg
atcctgctcggcgcttcgaccggcggcaccgaagcgttgcgcgaggtactgacccgactg
cccgcggggttgccgccgatcgcggtggtgcagcacatcccgccggtgttctccaaggct
tttgccgaccggctgagcgcgcaatgcgcattcgaagtccgcgaggcggccgacggcgac
atgctcaaacccggcctggcgctgatcgccccgggcaattttcacctgatggtccagtgg
cacgccgaccactatcgcgcccgcgtcaccacgggtccgcaaatctggcaccagcgtccc
gccgtcgacgtgctgttcaaatcggcggcggattgcggcgccgcgccccacgccatcgcc
ggcgtattgacgggcatgggcaaggatggcgcggaggggctgctgcgactacgcgggctc
ggtgcgattacatttgcccaggacgaggcgagttgtgtggtctatggcatgccgcgtgca
gcttgggaaaacggcgcggctcaacgacagattccgctcgaccgcatcgcagatttcata
gtccatccgcctagcccgcctccgccactgtctgacgcgagcaccctcgcgccggcgttg
tcatga

DBGET integrated database retrieval system