KEGG   Opitutus terrae: Oter_0429Help
Entry
Oter_0429         CDS       T00689                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
ote  Opitutus terrae
Pathway
ote02020  Two-component system
ote02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ote00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Oter_0429
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Oter_0429
Enzymes [BR:ote01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Oter_0429
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Oter_0429
Two-component system [BR:ote02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Oter_0429
Bacterial motility proteins [BR:ote02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Oter_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ACB73719
UniProt: B1ZR52
Position
503182..504267
Genome map
AA seq 361 aa AA seqDB search
MNRRIRVLIVDDSAVVRRLVTEALRADPEIEVVGTAADPYVARDRIKELDPDVLTLDLEM
PRMDGLTFLRILMDQHPMPVVIMSSLSQKGSDYALEALRLGAFDVLGKPSGAYSFGDLGA
QLIARVKAAGGARLRRPSTGTAAAPVRTAPRTGAASARQLILLGASTGGTEALREVLTRL
PAGLPPIAVVQHIPPVFSKAFADRLSAQCAFEVREAADGDMLKPGLALIAPGNFHLMVQW
HADHYRARVTTGPQIWHQRPAVDVLFKSAADCGAAPHAIAGVLTGMGKDGAEGLLRLRGL
GAITFAQDEASCVVYGMPRAAWENGAAQRQIPLDRIADFIVHPPSPPPPLSDASTLAPAL
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcgcatccgggtactcattgtcgacgactcggccgtcgtccgaagactcgtg
accgaggcgctgcgggccgatcccgaaatcgaagtggtcggcacggcggcggatccctac
gtggcgcgcgatcggatcaaggagctcgatcctgacgtgctgacgctggatctggaaatg
ccgcggatggatgggctgaccttcctgcggatcctgatggaccagcacccgatgcccgtg
gtgatcatgagctcgctttcccagaagggctcggactacgcgctcgaggcgctgcggctc
ggagccttcgacgtgctcggcaagccatcgggggcgtattccttcggcgacctcggcgcg
cagctgatcgcgcgcgtcaaggccgcgggcggcgcgcggctccggcggccgtcgaccggc
accgcggcggcgcccgtgcgcacggcgccgcgaaccggcgcggcctcggcgcggcagctg
atcctgctcggcgcttcgaccggcggcaccgaagcgttgcgcgaggtactgacccgactg
cccgcggggttgccgccgatcgcggtggtgcagcacatcccgccggtgttctccaaggct
tttgccgaccggctgagcgcgcaatgcgcattcgaagtccgcgaggcggccgacggcgac
atgctcaaacccggcctggcgctgatcgccccgggcaattttcacctgatggtccagtgg
cacgccgaccactatcgcgcccgcgtcaccacgggtccgcaaatctggcaccagcgtccc
gccgtcgacgtgctgttcaaatcggcggcggattgcggcgccgcgccccacgccatcgcc
ggcgtattgacgggcatgggcaaggatggcgcggaggggctgctgcgactacgcgggctc
ggtgcgattacatttgcccaggacgaggcgagttgtgtggtctatggcatgccgcgtgca
gcttgggaaaacggcgcggctcaacgacagattccgctcgaccgcatcgcagatttcata
gtccatccgcctagcccgcctccgccactgtctgacgcgagcaccctcgcgccggcgttg
tcatga

DBGET integrated database retrieval system