KEGG   Opitutus terrae: Oter_0564Help
Entry
Oter_0564         CDS       T00689                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ote  Opitutus terrae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oter_0564
   01230 Biosynthesis of amino acids
    Oter_0564
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oter_0564
  Energy metabolism
   00680 Methane metabolism
    Oter_0564
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oter_0564
Enzymes [BR:ote01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Oter_0564
Exosome [BR:ote04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Oter_0564
  Exosomal proteins of melanoma cells
   Oter_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
682137..682754
Genome map
AA seq 205 aa AA seqDB search
MTTTLYLVRHAQSLPLMHQPEPDWALSPAGEAQATGLVPALAPLGITRIYTSPYRRCRDT
LVPFADACGLEIAVHEGLRERRIAGQWVPDFREVWRRSWEDFSFALDGGECSWTCRARIA
AAVDELVHRHPGETLALGSHGNALALFLHFVEPAFGVHDASAIRTPEILKVTHSDGRYHW
RRDFHAGAGFEVLATDFRLTPGIVA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgacgctgtatctcgtgcggcatgcgcagagcttgcccttgatgcatcagccg
gaaccggattgggcgctctcgcccgccggcgaagctcaggcgaccggactggtgccagcg
ctcgcgccgctcggaatcacgcggatctacaccagcccctaccgccgctgtcgcgacacg
ctcgtcccgttcgcagatgcctgcggcctcgagatcgccgtgcacgaaggcctgcgcgaa
cgtcgcatcgccgggcagtgggtgccggactttcgcgaggtgtggcgacgctcgtgggag
gatttctcgttcgcgctcgacggcggcgagtgctcgtggacctgccgtgcgcggatcgcc
gccgcggtggacgaactcgtgcaccgtcatccgggcgagacgctggcgctcggctcgcat
ggcaatgccctcgcgctcttcctgcacttcgtcgagcccgcgttcggcgtgcacgacgcg
agcgccattcgcacacccgagatcctgaaagtgactcattcggatggccgctatcactgg
cgccgtgacttccatgcaggcgccggcttcgaggtgctcgccaccgatttccggctcacg
ccgggcatcgtcgcgtag

DBGET integrated database retrieval system