KEGG   Opitutus terrae: Oter_0793Help
Entry
Oter_0793         CDS       T00689                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ote  Opitutus terrae
Pathway
ote00230  Purine metabolism
ote01100  Metabolic pathways
Module
ote_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Oter_0793
Enzymes [BR:ote01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Oter_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 MMR_HSR1 AAA_29 CPT AAA_16 AAA_25 NACHT Viral_helicase1 ATP_bind_1 AAA_17 RsgA_GTPase AAA_30 ABC_tran Mg_chelatase RNA_helicase Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ACB74081
UniProt: B1ZVI4
Position
complement(969812..970474)
Genome map
AA seq 220 aa AA seqDB search
MENVAGQSPQPGAHSLTPTAVLLVLAGPAGSGKSTLCDRLVLEDPSFSRVITTTTRAPRP
GEINGVHYHFFTPEEFDRRVAAGEFLEWAWVHGKPGAGVDRRYGTLKASVLEPLARGQNL
VMSVDVQGVESFRQAARANPLLARHLVTVFILVDHDRLIARMRSRAQDNEAEIAGRMKTA
ERELKEAHKFDFRIESKTRDEDFATLRSILEQARARVAAK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtcgccggccagagcccgcagccgggagctcacagcctaacgcccaccgct
gttcttctcgtcctggccgggccggccggctccggcaagagcacgctgtgtgaccgactc
gtcttggaggatccgtcgttctcgcgcgtgatcaccaccaccacgcgcgcgccgcggccg
ggggagatcaacggcgtgcactaccatttcttcaccccggaagagttcgatcggcgggtg
gcggccggcgagttcctcgagtgggcgtgggtgcacggcaaacctggcgcgggcgtcgat
cgccgctacggcacgttgaaggcgagtgtgctcgaaccgctcgcgcgcggacagaacctc
gtcatgagcgtcgacgtgcagggggtggaaagtttccgccaggctgcgcgcgcaaatccg
ctgctcgcgcggcatctggtcaccgtgttcatcctggtggatcacgaccggctgatcgcg
cgaatgcgctcgcgcgcgcaggacaacgaggcggagatcgcgggccggatgaagaccgcc
gagcgtgagctgaaggaagcgcacaagttcgattttcgcatcgagagcaaaacacgcgac
gaggacttcgccacgctgcggagcattctggagcaggcgcgagcgcgcgtggcggcgaag
tag

DBGET integrated database retrieval system