KEGG   Opitutus terrae: Oter_0816Help
Entry
Oter_0816         CDS       T00689                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ote  Opitutus terrae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oter_0816
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oter_0816
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oter_0816
Enzymes [BR:ote01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Oter_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
993758..995083
Genome map
AA seq 441 aa AA seqDB search
MSHPIQFLLRAKEMPTHWYNLLADFPEPLPPPLHPGTKQPATLDDMKAIFPENLIAQEMS
AERMIEIPQEVRDVYALYRPTPLLRAVRLEKALKTPAHIYYKYEGVSPAGSHKPNTAIPQ
AYYNKLAGTKRLATETGAGQWGSSLAMACQVFGLECTVYMVKVSFHQKPYRKLLMQTYGA
KVYASPSRHTAFGRKMLAESPDSPGSLGAAISEAIEDTIKNHDTKYALGSVLNHVCLHQT
VIGEETMKQMELAGEEPDIIYGCAGGGSNFAGIAFPFLREKIQGKKKFRVVAVEPASCPS
LTQGELRYDFGDMAETTPLMMMYTLGHKFMPPSIHAGGLRYHGMAPMVSHCKKLGLIDAV
AVTQTKVFEAGVLFARSEGLVPAPESSHAIAAVVDEAIKCREEGKKRVLVFNLSGNGLLD
LAAYDTYLSGEMQHPTSGGGA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagccatccgatccaattcctgcttcgcgccaaagagatgccgacgcactggtataac
ctgctcgcggatttccccgagccgctgccgccgccgctgcatccgggcacgaagcagccc
gcgacgttggacgacatgaaggcgatcttcccggaaaacctgatcgcgcaagaaatgagc
gcggagcggatgatcgagattccgcaggaagtgcgtgacgtttacgcgctctaccggccc
acgccgttgctccgcgcggttcggctcgaaaaggcgctcaagacgccggctcacatttac
tacaaatacgagggcgtcagccccgcgggcagtcacaagccgaacacggcgattccccaa
gcctactacaacaagctggccggcacgaaacggctcgcgaccgaaaccggcgccggccag
tggggctcgtcgctcgcgatggcctgccaggtcttcggactcgagtgcaccgtctacatg
gtgaaggtgagctttcaccagaagccctaccgcaaactgctcatgcagacctatggggcc
aaggtttacgcgagcccgagccggcacaccgccttcggccgcaaaatgctcgcggagagt
ccggactcgcccggcagcctcggcgccgcgatcagcgaggcgatcgaggacacgatcaaa
aaccacgacacgaaatacgcgctcggcagcgtgctgaaccacgtgtgtctgcaccagacg
gtgatcggcgaggaaacgatgaagcaaatggaactcgccggcgaggagcccgacatcatc
tacggctgcgccggcggcggcagcaatttcgccggtatcgcgtttccgttcctgcgcgaa
aaaattcaggggaaaaagaaattccgcgtcgtcgcggtcgagcccgcctcctgtccgtcg
ctcacccagggcgaactccgctacgatttcggcgacatggccgagaccacgccgctgatg
atgatgtatacgctcggccacaaattcatgccgccgagcatccacgccggcgggctgcgc
taccacggcatggcgccgatggtgagccactgcaaaaagctcgggttgatcgacgccgtc
gcggtgacacagacgaaggtcttcgaagccggcgtgctgtttgcgcgttccgaaggactc
gtgcccgcgccggaatcgtcgcacgccatcgccgccgttgtcgacgaggccatcaagtgc
cgcgaggaaggaaagaagcgcgtgctcgtcttcaatctcagcggcaacggtctgctcgat
ctcgcagcctacgacacgtatctgtccggcgagatgcagcacccgaccagcggcggcggc
gcgtga

DBGET integrated database retrieval system