KEGG   Opitutus terrae: Oter_0816Help
Entry
Oter_0816         CDS       T00689                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ote  Opitutus terrae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oter_0816
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oter_0816
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oter_0816
Enzymes [BR:ote01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Oter_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
993758..995083
Genome map
AA seq 441 aa AA seqDB search
MSHPIQFLLRAKEMPTHWYNLLADFPEPLPPPLHPGTKQPATLDDMKAIFPENLIAQEMS
AERMIEIPQEVRDVYALYRPTPLLRAVRLEKALKTPAHIYYKYEGVSPAGSHKPNTAIPQ
AYYNKLAGTKRLATETGAGQWGSSLAMACQVFGLECTVYMVKVSFHQKPYRKLLMQTYGA
KVYASPSRHTAFGRKMLAESPDSPGSLGAAISEAIEDTIKNHDTKYALGSVLNHVCLHQT
VIGEETMKQMELAGEEPDIIYGCAGGGSNFAGIAFPFLREKIQGKKKFRVVAVEPASCPS
LTQGELRYDFGDMAETTPLMMMYTLGHKFMPPSIHAGGLRYHGMAPMVSHCKKLGLIDAV
AVTQTKVFEAGVLFARSEGLVPAPESSHAIAAVVDEAIKCREEGKKRVLVFNLSGNGLLD
LAAYDTYLSGEMQHPTSGGGA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagccatccgatccaattcctgcttcgcgccaaagagatgccgacgcactggtataac
ctgctcgcggatttccccgagccgctgccgccgccgctgcatccgggcacgaagcagccc
gcgacgttggacgacatgaaggcgatcttcccggaaaacctgatcgcgcaagaaatgagc
gcggagcggatgatcgagattccgcaggaagtgcgtgacgtttacgcgctctaccggccc
acgccgttgctccgcgcggttcggctcgaaaaggcgctcaagacgccggctcacatttac
tacaaatacgagggcgtcagccccgcgggcagtcacaagccgaacacggcgattccccaa
gcctactacaacaagctggccggcacgaaacggctcgcgaccgaaaccggcgccggccag
tggggctcgtcgctcgcgatggcctgccaggtcttcggactcgagtgcaccgtctacatg
gtgaaggtgagctttcaccagaagccctaccgcaaactgctcatgcagacctatggggcc
aaggtttacgcgagcccgagccggcacaccgccttcggccgcaaaatgctcgcggagagt
ccggactcgcccggcagcctcggcgccgcgatcagcgaggcgatcgaggacacgatcaaa
aaccacgacacgaaatacgcgctcggcagcgtgctgaaccacgtgtgtctgcaccagacg
gtgatcggcgaggaaacgatgaagcaaatggaactcgccggcgaggagcccgacatcatc
tacggctgcgccggcggcggcagcaatttcgccggtatcgcgtttccgttcctgcgcgaa
aaaattcaggggaaaaagaaattccgcgtcgtcgcggtcgagcccgcctcctgtccgtcg
ctcacccagggcgaactccgctacgatttcggcgacatggccgagaccacgccgctgatg
atgatgtatacgctcggccacaaattcatgccgccgagcatccacgccggcgggctgcgc
taccacggcatggcgccgatggtgagccactgcaaaaagctcgggttgatcgacgccgtc
gcggtgacacagacgaaggtcttcgaagccggcgtgctgtttgcgcgttccgaaggactc
gtgcccgcgccggaatcgtcgcacgccatcgccgccgttgtcgacgaggccatcaagtgc
cgcgaggaaggaaagaagcgcgtgctcgtcttcaatctcagcggcaacggtctgctcgat
ctcgcagcctacgacacgtatctgtccggcgagatgcagcacccgaccagcggcggcggc
gcgtga

DBGET integrated database retrieval system