KEGG   Opitutus terrae: Oter_0865Help
Entry
Oter_0865         CDS       T00689                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ote  Opitutus terrae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Oter_0865
Enzymes [BR:ote01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Oter_0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1064999..1066567)
Genome map
AA seq 522 aa AA seqDB search
MDSPLPTWLTTRSSGVLAHVSSLPGLYGIGNLGPGAREFVDFLAEARVRYWQICPIGPTG
YGDSPYQLFSSAAGNPYFIDLGELEQAGLIERTELAELRRLPARRVDYGALYRTFWPVLA
QAADRFAASGADRLPGFGPLADFRRQHAGWLESFADFMALKDHFGGEAWMTWPEPVRAWT
PELHDTLPADVRRNAERHVFYQYVFFAQWERLRRHAEARGVGIIGDVPIFVALDSADTWQ
HRAVFRLDERGAPLAVAGVPPDYYSAYGQLWGNPLYDWKHLAATGYAWWIDRLRAAFDLY
DVIRLDHFRGFDSYWEIPADAMDARSGQWQRGPGLPFFQAIEAALPTARIIAEDLGYIGP
DVVQLRRATGLPGMKVLQFAYGHDANNVNLPHHYPLNSVAYTGTHDNNTLRGWLESLAPE
YRALVNDYFKLGSSRSSWPMIRAALATVSRLAVIPMQDLLDLGADAVLNRPGTTVGNWQW
RFTREQLTRLAKGKRATLRHWIELYDRTGDHELRDYSEPPRA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggattctcccttgcccacctggctcacgacccgcagctccggcgtgctggcgcacgtc
tcgagcctgccgggattgtatggcatcggtaacctgggtccgggtgcacgggagttcgtc
gatttcctcgccgaagcacgcgtgcgctactggcagatctgccccatcggaccgacgggc
tacggcgactcgccttaccagcttttctccagcgctgccggcaatccgtacttcatcgac
ctcggcgagctcgagcaggccgggttgatcgaacgcaccgagctcgcggagttgcgccgg
ctgcccgcgcgacgcgtcgattacggcgcgctgtatcgcaccttctggccagtgctcgcg
caagccgccgaccggtttgcggccagtggcgccgaccggctgccgggattcggcccgctc
gcggattttcgccggcaacacgctggctggctcgaatcgttcgccgatttcatggcgctc
aaggatcacttcggcggcgaagcctggatgacctggcccgaacccgtgcgcgcctggacg
ccggagctccacgacacactacccgcggacgtacggcgcaacgccgagcggcatgtgttt
taccaatacgttttctttgcgcaatgggaacgtctgcggcgtcacgcggaagcccgcggc
gtcggcatcattggcgatgtgccgattttcgtcgccctcgacagcgcggacacctggcag
catcgcgcggttttccggctcgacgagcggggtgcgccgctcgccgtcgccggcgtgccc
ccggactattactccgcctacgggcaattgtggggcaatccactctacgactggaagcac
ctcgcggccaccggctacgcgtggtggatcgaccggctgcgcgcggcgttcgacctctac
gacgtcatccggctcgatcacttccgcgggttcgacagctactgggaaatccccgcggac
gcgatggacgctcgctccggacagtggcaacgcggcccggggctgccgtttttccaggcc
atcgaagccgcgctgccgacggcccgcatcatcgccgaggatctcggctacatcggaccc
gacgtggtgcagctgcggcgggcgacgggattgcccggtatgaaagtgctgcagttcgcc
tacggacacgacgccaacaacgtcaacctgccgcatcactatccgctcaacagcgtcgcc
tacaccggcacgcacgacaacaacacccttcgcggctggctggaatcgctcgcgccggaa
tatcgcgcgctcgtgaacgattacttcaagctcggcagctcgcgctcgtcgtggccgatg
attcgcgccgcgctcgccacggtctcgcggctcgcggtcattcccatgcaagacctgctg
gatctcggcgccgacgcggtgttgaaccggcccggcaccacggtcggcaactggcagtgg
cgcttcactcgggagcagttgacacggctcgccaaaggcaagcgcgccacgctgcgccac
tggatcgagctctacgatcgcaccggcgaccacgagttgcgcgactacagcgaaccacct
cgcgcctga

DBGET integrated database retrieval system