KEGG   Opitutus terrae: Oter_1287Help
Entry
Oter_1287         CDS       T00689                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ote  Opitutus terrae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Oter_1287
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Oter_1287
Enzymes [BR:ote01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Oter_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1598424..1599854
Genome map
AA seq 476 aa AA seqDB search
MYSHFRSLTLLASFGGASFAFAAGVPSAQVYLTQKDAPHRLAATGALRFAPLPQPMEKQQ
CVFVDPTHEFETLLGIGGAITDAAAETFDKLPETKRAELLRAYYDPRAGIGYSLARTHIN
SCDFSSGSYTYVAEGDRELKSFDIAPDLRHRIPLLRAALKTAGPGLTVYASPWSPPAWMK
DSGDMLHGGKLRPDMRAAWANYFVKFIHAYEQAGVPLWGVTVQNEPMAVQIWESCIFTAE
EERDFVRDHLGPTLKASGLGGKKIVGWDHNRTQLYQRATTLLSDPAAAQYLWGLGFHWYV
NDTFENVRRVRDAFPQAQLMMTEGCNGPFDFAKMNDWDLAENYGRSMIHDFNNGAVGWTD
WNILLDETGGPNHVGNFCFAPVHGDTRTGELHFTPAFYYIGHFSKFIRPGARRIIASPTV
DRLIATAFKNTDGSIAVVVMNQSAEDQPFHVWMNGQAASTRCPARSIMTVVIGVEQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtattcacacttccgctcactcacgttgctggcatcgtttggcggcgcgtcgttcgcg
tttgccgccggcgtgccctccgcgcaggtttacctgacgcaaaaagacgcgccgcaccgg
ctcgcggcgaccggagccttgcgcttcgcaccgttgccccagcccatggagaagcagcag
tgcgtgtttgtggatccgacgcacgagttcgaaacactgctcggcattggcggcgcgatc
accgacgcggcggcggagacattcgacaagctgccggagacgaaacgcgcggagctgcta
cgcgcctactacgatccacgagccgggatcggttactcgctcgcgcggacccacatcaac
agctgcgatttttcctccggcagctacacctacgtggcggagggtgaccgcgagctgaag
agcttcgatatcgcgccggacctgcgacaccggatcccgctgctgcgggcggcgctgaag
accgccggaccggggttgacggtttacgccagcccgtggagcccaccggcgtggatgaag
gacagcggcgacatgctgcatggcggcaagctgcggccggacatgcgcgcggcgtgggcg
aactatttcgtaaagttcatccacgcctatgaacaagcgggcgtgccgctctggggcgtg
acggtgcagaacgagccgatggcggtgcagatctgggagtcgtgcatcttcacggcggag
gaggagcgcgacttcgtgcgcgatcacctcggcccgacactgaaggcgagcgggctgggc
gggaagaagatcgtcggctgggaccacaaccgcacgcaactctaccagcgcgcgacgacg
ttgctcagcgatcctgccgccgcgcagtatctgtggggcctcgggtttcactggtatgtg
aacgacacgttcgaaaacgtccgccgcgtgcgcgatgccttcccgcaagcgcagttgatg
atgaccgaggggtgcaacggaccattcgatttcgccaagatgaacgactgggatctggcc
gaaaactacggccgctcgatgatccacgatttcaacaacggtgcggtcggttggaccgac
tggaacatcctgctcgacgagacgggcgggccgaaccacgtggggaacttctgctttgcg
ccggtgcatggcgacacgcggacgggcgagctgcatttcacgccggcgttctactacatc
ggccatttttcgaagttcatccgacccggcgcgcggcggatcatcgcctcgccgacggtg
gaccggttgatcgcgacggcgttcaaaaacaccgacggcagcatcgctgtcgtggtgatg
aatcagtcggccgaagatcagccgttccacgtctggatgaacggccaggcagcgtctacg
cgctgtccggcgcggtcgatcatgacggtggtgatcggggtggagcagtga

DBGET integrated database retrieval system